|
||||||
|
UniGene Name: sp_v3.0_unigene68564
Length: 180 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene68564
C |
|
Ace file of the UniGene sp_v3.0_unigene68564 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ribosomal protein S6 kinase, putative n=1 Tax=Ricinus communis RepID=B9R905_RICCO | - | - | 7.0e-13 | 77% |
| FL-Next | sp=Serine/threonine-protein kinase AtPK1/AtPK6; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 82% |
| Sma3 | Serine/threonine-protein kinase AtPK19 | - | - | 4.12e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase C. | EC:2.7.11.13 | - | 7.029e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphatidylinositol signaling system | 04070 | 7.029e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT3G08720; ATPK1; ATPK19; ATPK6; Aspk11; At3g08720; At3g08730; CHLREDRAFT_39110; F17O14.19; F17O14.20; GSVIVT00016180001; GSVIVT00037509001; LOC_Os03g21620; MICPUCDRAFT_3206; MICPUN_56023; OSJNBa0008J01.16; OSTLU_3119; Os03g0334000; Os07g0680900; OsI_2735 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of translation | GO:0045727 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | AGC-kinase, C-terminal | IPR000961 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Protein kinase, C-terminal | IPR017892 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G08730.1 | ATPK1, ATPK6, ATS6K1, PK6, PK1, S6K1 protein-serine kinase 1 chr3:2651581-2653363 REVERSE LENGTH=465 | 2.0e-16 | 82% |
| RefSeq | Arabidopsis thaliana | NP_187485.1 | serine/threonine-protein kinase AtPK1/AtPK6 [Arabidopsis thaliana] | 3.0e-16 | 82% |
| RefSeq | Populus trichocarpa | XP_002318010.1 | predicted protein [Populus trichocarpa] | 2.0e-17 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P42818
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 224 aas, your sequence is shorter than subject: 53 - 465
Fln protein:
L
Protein Length:
54
Fln nts:
C
Fln Alignment:
GG46A6U01DBU9A___HPFIVQLRYSFQTKHKLFLVSDFINGGHLFFQLQRQGLF
P42818_______________HPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
