SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene68544

Length: 297 nt

UniGene Fasta

>sp_v3.0_unigene68544
CGTCGTGACCTTGGCTGTCACTCAGAGTCTTCAACCTGTCAATACACATGATAAGGAGGCACTGTTGGCCTCTGATCTTGGTCTGAAGCAAAGTAAGCAGCCTACAGAGTTCTTCTGCAAGACATTGACAGCAAGCGATACAAGTACCCATGGCGGCTTCTCTGTACCTCGCCGTGCCGCAGAGAAAATATTTCCACCACTAGATTATACGATGCAACCACCAGCTCAAGAACTTGTGGCCAGAGATTTGCATGATCATGCATGGACATTCAGACATATCTATCGTGGTCAGCCAAA

Ace file of the UniGene sp_v3.0_unigene68544

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Auxin response factor, putative n=1 Tax=Ricinus communis RepID=B9RR61_RICCO	-	-	1.00053e-42	90%
FL-Next	tr=Putative auxin response factor 3/4; Pinus pinaster (Maritime pine).	-	-	0.0	62%
Sma3	Auxin response factor, putative	-	-	6.01858e-42	-

Source	Gene names
Sma3	ARF1; ARF10; ARF11; ARF12; ARF14; ARF15; ARF16; ARF17; ARF18; ARF19; ARF2; ARF21; ARF22; ARF23; ARF24; ARF25; ARF3; ARF4; ARF5; ARF6; ARF6A; ARF6B; ARF7; ARF7A; ARF7B; ARF8; ARF9; At1g19220; At1g19850; At1g30330; At1g34310; At1g34410; At1g35520; At1g35540

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	transcription activator activity	GO:0016563	Molecular Function	-
Sma3	protein dimerization activity	GO:0046983	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	negative regulation of cell proliferation	GO:0008285	Biological Process	-
Sma3	gravitropism	GO:0009630	Biological Process	-
Sma3	phototropism	GO:0009638	Biological Process	-
Sma3	response to ethylene stimulus	GO:0009723	Biological Process	-
Sma3	response to hormone stimulus	GO:0009725	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	blue light signaling pathway	GO:0009785	Biological Process	-
Sma3	auxin metabolic process	GO:0009850	Biological Process	-
Sma3	flower development	GO:0009908	Biological Process	-
Sma3	positive regulation of flower development	GO:0009911	Biological Process	-
Sma3	longitudinal axis specification	GO:0009942	Biological Process	-
Sma3	fruit dehiscence	GO:0010047	Biological Process	-
Sma3	vegetative phase change	GO:0010050	Biological Process	-
Sma3	leaf senescence	GO:0010150	Biological Process	-
Sma3	abaxial cell fate specification	GO:0010158	Biological Process	-
Sma3	floral organ abscission	GO:0010227	Biological Process	-
Sma3	leaf vascular tissue pattern formation	GO:0010305	Biological Process	-
Sma3	lateral root primordium development	GO:0010386	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3		GO:0016481	Biological Process	-
Sma3	negative regulation of transcription, DNA-dependent	GO:0045892	Biological Process	-
Sma3	root development	GO:0048364	Biological Process	-
Sma3	leaf development	GO:0048366	Biological Process	-
Sma3	ovule development	GO:0048481	Biological Process	-
Sma3	meristem development	GO:0048507	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Aminotransferase, class-II, pyridoxal-phosphate binding site	IPR001917	-	-
Sma3	Smr protein/MutS2 C-terminal	IPR002625	-	-
Sma3	AUX/IAA protein	IPR003311	-	-
Sma3	B3 DNA binding domain	IPR003340	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Ribosomal protein S12/S23	IPR006032	-	-
Sma3	Protein of unknown function DUF482	IPR007434	-	-
Sma3	Auxin response factor	IPR010525	-	-
Sma3	Aux/IAA-ARF-dimerisation	IPR011525	-	-
Sma3	Domain of unknown function DUF1771	IPR013899	-	-
Sma3	DNA methylase, N-4 cytosine-specific, conserved site	IPR017985	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT1G19220.1	ARF19, IAA22, ARF11 auxin response factor 19 chr1:6628395-6632779 REVERSE LENGTH=1086	84%
RefSeq	Arabidopsis thaliana	NP_173356.1	auxin response factor 19 [Arabidopsis thaliana]	84%
RefSeq	Populus trichocarpa	XP_002326300.1	predicted protein [Populus trichocarpa]	86%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: E1UHY2

Fln msg: Distance to subject end: 683 aas, your sequence is shorter than subject: 98 - 919

Fln protein: VVTLAVTQSLQPVNTHDKEALLASDLGLKQSKQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYTMQPPAQELVARDLHDHAWTFRHIYRGQP

Protein Length: 99

Fln nts: CGTCGTGACCTTGGCTGTCACTCAGAGTCTTCAACCTGTCAATACACATGATAAGGAGGCACTGTTGGCCTCTGATCTTGGTCTGAAGCAAAGTAAGCAGCCTACAGAGTTCTTCTGCAAGACATTGACAGCAAGCGATACAAGTACCCATGGCGGCTTCTCTGTACCTCGCCGTGCCGCAGAGAAAATATTTCCACCACTAGATTATACGATGCAACCACCAGCTCAAGAACTTGTGGCCAGAGATTTGCATGATCATGCATGGACATTCAGACATATCTATCGTGGTCAGCCAAA

Fln Alignment:

GG46A6U01AN3EG___NTHDKEALLASDLGLKQSKQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYTMQPPAQELVARDLHDHAWTFRHIYRGQP
E1UHY2_______________DSEKNEKCMEEQLSVPPSSTP-HMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQELVAKDLHGREWRFRHIFRGQP

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain