UniGene Name: sp_v3.0_unigene68506
Length: 117 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene68506
C |
Ace file of the UniGene sp_v3.0_unigene68506
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | UDP-glucosyltransferase-like protein (Fragment) n=13 Tax=Picea sitchensis RepID=E0ZGU3_PICSI | - | - | 4.0e-09 | 93% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 3.331e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g22400; At1g78270; At2g36770; At2g36790; At2g36800; DOGT1; DcA82; DcT11; F12K8.26; F13K3.19; F13K3.20; PHYPADRAFT_123741; PHYPADRAFT_162654; RCOM_0606290; T16E15.1; T16E15.4; UFGT; UGT5; UGT73C5; UGT73C6; UGT73E6; UGT85A1; ZOG2; ZOG3; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
| Sma3 | UDP-glucosyltransferase activity | GO:0035251 | Molecular Function | 0.0 | - |
| Sma3 | trans-zeatin O-beta-D-glucosyltransferase activity | GO:0050403 | Molecular Function | 0.0 | - |
| Sma3 | cis-zeatin O-beta-D-glucosyltransferase activity | GO:0050502 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid metabolic process | GO:0016131 | Biological Process | 0.0 | - |
| Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucuronosyl/UDP-glucosyltransferase | IPR002213 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G78270.1 | AtUGT85A4, UGT85A4 UDP-glucosyl transferase 85A4 chr1:29450691-29452223 REVERSE LENGTH=489 | 4.0e-11 | 82% |
| RefSeq | Arabidopsis thaliana | NP_177950.1 | UDP-glucosyl transferase 85A4 [Arabidopsis thaliana] | 5.0e-11 | 82% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LNU7
Fln msg: Distance to subject end: 105 aas, your sequence is shorter than subject: 38 - 491
Fln protein:
V
Protein Length:
39
Fln nts:
C
Fln Alignment:
GG46A6U01A85MD___VQWSSQLKVLSHPSVGGFLTHCGWNSILES
B8LNU7_______________VQWSSQLEVLSHPSVGGFLTHCGWNSILES

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta