UniGene Name: sp_v3.0_unigene68488
Length: 214 nt
UniGene Fasta |
---|
>sp_v3.0_unigene68488
C |
Ace file of the UniGene sp_v3.0_unigene68488 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
Sma3 | Synaptotagmin, putative | - | - | 6.739e-14 | - |
Source | Gene names |
---|---|
Sma3 | AT4g20080; At1g04150; At1g51570; At1g74720; At3g03680; At3g57880; At4g20080; At5g12970; At5g17980; F19C24.20; F1M20.40; F20D22.8; F25A4.30; GSVIVT00000095001; GSVIVT00000407001; GSVIVT00003833001; GSVIVT00008858001; GSVIVT00024667001; GSVIVT00025351001; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | glutathione peroxidase activity | GO:0004602 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
Sma3 | Glutathione peroxidase | IPR000889 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Molybdopterin oxidoreductase, prokaryotic, conserved site | IPR006655 | - | 0.0 | - |
Sma3 | Protein of unknown function DUF1118 | IPR009500 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Phosphoribosyltransferase C-terminal | IPR013583 | - | 0.0 | - |
Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
Sma3 | Hemopexin/matrixin, conserved site | IPR018486 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G51570.1 | Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein chr1:19122358-19124688 REVERSE LENGTH=776 | 2.0e-24 | 63% |
RefSeq | Arabidopsis thaliana | NP_175568.1 | anthranilate phosphoribosyltransferase-like protein [Arabidopsis thaliana] | 3.0e-24 | 63% |
RefSeq | Populus trichocarpa | XP_002297795.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LL63
Fln msg: Distance to subject end: 406 aas, your sequence is shorter than subject: 71 - 758
Fln protein:
V
Protein Length:
72
Fln nts:
C
Fln Alignment:
GG46A6U01C9CP7___AVTQWFNLEK--------ENGEPSDKYHGRIHLRLCFDGGYHVMDEAAHLSSDLRPTAKQLWKPSIGVLELGIL
B8LL63_______________AIPRWFSLEKPAVAAAEGDSKKKEVKFASRIFLRLSLDGGYHVLDESTHYSSDLRPTHKHLWKSYIGILQVGIL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain