SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene68396

Length: 343 nt

UniGene Fasta

>sp_v3.0_unigene68396
CGTCGTGACCTTGGCTGTCACTCAGCTTTAGCAGGGAAGCCCTCCAACTCTTTGAACAAATGCAGCGATTTGGCATGAAGCCTGACCATGTCACGTTTGTTGGTGTTTTGTCAGCCTGCTGTCATGCTGGTCTAGTGGATGAGGGCTGGCAGTATTTTGATAGTATGAGAAAGTATTATCACATCACCCCTACAATGGACCATTATGGCTGCATGGTTAACCTTCTTGGTCGAGCTGGGCTCCTAGATGAGGCACTATTACTTTATCAATCAAATGCCAATAAAGCCAGATGCTACTGTATGGTTGTGTTTGCTTCGGTTATTGCAGAGCTCATGTCAATGTA

Ace file of the UniGene sp_v3.0_unigene68396

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Pentatricopeptide repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9S079_RICCO	-	-	2.0e-22	61%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	76%
Sma3	Pentatricopeptide (PPR) repeat-containing protein-like	-	-	2.504e-10	-

Source	Gene names
Sma3	A_TM021B04.2; At1g53600; At2g01510; At2g03880; At2g13600; At2g22070; At2g36730; At3g29230; At4g01030; At4g02750; At4g38010; At5g27110; At5g40410; At5g66520; B1045D11.23; F13K3.13; F20D10.130; F22G10.27; F2I9.13; F3I3.50; GSVIVT00000117001; GSVIVT000001380

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	diacylglycerol kinase activity	GO:0004143	Molecular Function	-
Sma3	ubiquitin thiolesterase activity	GO:0004221	Molecular Function	-
Sma3	monooxygenase activity	GO:0004497	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	deaminase activity	GO:0019239	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway	GO:0007205	Biological Process	-
Sma3	purine ribonucleoside monophosphate biosynthetic process	GO:0009168	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ribonuclease P	IPR000100	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Diacylglycerol kinase, accessory domain	IPR000756	-	-
Sma3	Beta-lactamase, class-A/D	IPR000871	-	-
Sma3	Tobamoviral movement protein	IPR001022	-	-
Sma3	Cytochrome P450	IPR001128	-	-
Sma3	Diacylglycerol kinase, catalytic domain	IPR001206	-	-
Sma3	Adenosine/AMP deaminase domain	IPR001365	-	-
Sma3	Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1	IPR001578	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Phosphotransferase system, HPr serine phosphorylation site	IPR002114	-	-
Sma3	Cytochrome P450, E-class, group I	IPR002401	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Domain of unknown function DUF221	IPR003864	-	-
Sma3		IPR006670	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3		IPR017442	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3		IPR017973	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G03880.1	REME1 Pentatricopeptide repeat (PPR) superfamily protein chr2:1181560-1183452 FORWARD LENGTH=630	2.0e-27	58%
RefSeq	Arabidopsis thaliana	NP_178481.1	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	3.0e-27	58%
RefSeq	Populus trichocarpa	XP_002332237.1	predicted protein [Populus trichocarpa]	3.0e-27	57%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LLJ0

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 70 aas, your sequence is shorter than subject: 113 - 644

Fln protein: S*PWLSLSFSREALQLFEQMQRFGMKPDHVTFVGVLSACCHAGLVDEGWQYFDSMRKYYHITPTMDHYGCMVNLLGRAGLLDEALLLYQSNANKARCYCMVVFASVIAELMSM

Protein Length: 114

Fln nts: CGTCGTGACCTTGGCTGTCACTCAGCTTTAGCAGGGAAGCCCTCCAACTCTTTGAACAAATGCAGCGATTTGGCATGAAGCCTGACCATGTCACGTTTGTTGGTGTTTTGTCAGCCTGCTGTCATGCTGGTCTAGTGGATGAGGGCTGGCAGTATTTTGATAGTATGAGAAAGTATTATCACATCACCCCTACAATGGACCATTATGGCTGCATGGTTAACCTTCTTGGTCGAGCTGGGCTCCTAGATGAGGCACTATTACTTTATCAATCAAATGCCAATAAAGCCAGATGCTACTGTATGGTTGTGTTTGCTTCGGTTATTGCAGAGCTCATGTCAATGTA

Fln Alignment:

GG46A6U01D7OE7___SREALQLFEQMQRFGMKPDHVTFVGVLSACCHAGLVDEGWQYFDSMRKYYHITPTMDHYGCMVNLLGRAGLLDEA
B8LLJ0_______________SKESLELFEQMQFTGLKPDRVTFVGVLSACCHAGLVDEGRQYFDIMTRFYHITPAMEHYGCMIDLLGRAGCFDEA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain