|
||||||
|
UniGene Name: sp_v3.0_unigene68281
Length: 198 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene68281
C |
|
Ace file of the UniGene sp_v3.0_unigene68281
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DNA-directed RNA polymerase (Fragment) n=2 Tax=Spermatophyta RepID=E0CQW1_VITVI | - | - | 1.0e-20 | 87% |
| FL-Next | sp=DNA-directed RNA polymerase II subunit RPB1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 77% |
| Sma3 | DNA-directed RNA polymerase | - | - | 5.553e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA-directed RNA polymerase. | EC:2.7.7.6 | - | 4.101e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 4.101e-11 | % | |
| Sma3 | Pyrimidine metabolism | 00240 | 4.101e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.101e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | At4g35800; F4B14.70; GSVIVT00015507001; Os05g0151000; OsJ_17146; OsJ_26081; P0001A07.9; PHYPADRAFT_101222; PHYPADRAFT_93853; RCOM_0782880; RPB1; RPB1-B1 or gene B1; RPB1-B2; RPB1-C; RPB205; RPII; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | DNA-directed RNA polymerase II, core complex | GO:0005665 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | DNA-directed RNA polymerase activity | GO:0003899 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | transcription from RNA polymerase II promoter | GO:0006366 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA polymerase II, heptapeptide repeat, eukaryotic | IPR000684 | - | 0.0 | - |
| Sma3 | RNA polymerase, alpha subunit | IPR000722 | - | 0.0 | - |
| Sma3 | RNA polymerase, N-terminal | IPR006592 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 3 | IPR007066 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 7 | IPR007073 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 6 | IPR007075 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 1 | IPR007080 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 5 | IPR007081 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb1, domain 4 | IPR007083 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G35800.1 | NRPB1, RPB1, RNA_POL_II_LSRNA_POL_II_LS, RNA_POL_II_LS RNA polymerase II large subunit chr4:16961115-16967892 REVERSE LENGTH=1839 | 5.0e-25 | 77% |
| RefSeq | Arabidopsis thaliana | NP_195305.2 | DNA-directed RNA polymerase II subunit RPB1 [Arabidopsis thaliana] | 7.0e-25 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P18616
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 338 aas, your sequence is shorter than subject: 65 - 1839
Fln protein:
S
Protein Length:
66
Fln nts:
C
Fln Alignment:
GG46A6U01EYFVG___VTENIMLGQLAPIGTGDCTLYLNEKMLQQAIALQLPSYMEGLDFGMSPTRSPITGSP
P18616_______________VTENIMLGQLAPIGTGDCELYLNDEMLKNAIELQLPSYMDGLEFGMTPARSPVSGTP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
