|
||||||
|
UniGene Name: sp_v3.0_unigene68265
Length: 227 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene68265
C |
|
Ace file of the UniGene sp_v3.0_unigene68265
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DEAD-box ATP-dependent RNA helicase 42 n=3 Tax=Arabidopsis RepID=RH42_ARATH | - | - | 2.0e-11 | 51% |
| FL-Next | sp=DEAD-box ATP-dependent RNA helicase 42; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 71% |
| Sma3 | DEAD-box ATP-dependent RNA helicase 45 | - | - | 9.358e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on acid anhydrides, In phosphorous-containing anhydrides. | EC:3.6.1.- | - | 3.582e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 3.582e-09 | % | |
| Sma3 | Lipopolysaccharide biosynthesis | 00540 | 3.582e-09 | % | |
| Sma3 | Folate biosynthesis | 00790 | 3.582e-09 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.582e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g20920; At3g09620; F11F8_21; F9H16.10; GSVIVT00036305001; LOC_Os08g05810; LOC_Os08g06344; MICPUCDRAFT_55903; MICPUN_95935; OSTLU_34710; Os08g0154200; Os08g0159900; OsI_27901; OsJ_26071; OsJ_26125; Ot09g00780; P0498E12.131; P0672D01.114; PHYPADRAFT_1499 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | RNA helicase, DEAD-box type, Q motif | IPR014014 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | Intermediate filament protein, conserved site | IPR018039 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G20920.1 | P-loop containing nucleoside triphosphate hydrolases superfamily protein chr1:7285342-7288842 FORWARD LENGTH=1166 | 1.0e-15 | 71% |
| RefSeq | Arabidopsis thaliana | NP_001077571.1 | DEAD-box ATP-dependent RNA helicase 42 [Arabidopsis thaliana] | 2.0e-15 | 71% |
| RefSeq | Populus trichocarpa | XP_002307002.1 | predicted protein [Populus trichocarpa] | 7.0e-15 | 90% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8H0U8
Fln msg: Distance to subject end: 76 aas, your sequence is shorter than subject: 75 - 1166
Fln protein:
R
Protein Length:
76
Fln nts:
C
Fln Alignment:
GG46A6U01AF8MM___VSGLPGAYPV-----PTDXXXXXXXXXXXXXXXXXXXKIQKDALPEHYEAELEINDFPQNARWKVTHKET
Q8H0U8_______________LAAMPGVLPVTVPTLPSEGAGRAAAMVAAMNLQHNLAKIQADAMPEHYEAELEINDFPQNARWKVTHKET
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
