|
||||||
|
UniGene Name: sp_v3.0_unigene68244
Length: 218 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene68244
C |
|
Ace file of the UniGene sp_v3.0_unigene68244
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial n=3 Tax=Arabidopsis RepID=AGT21_ARATH | - | - | 8.0e-18 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alanine--glyoxylate transaminase. | EC:2.6.1.44 | - | 2.153e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 2.153e-06 | % | |
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 2.153e-06 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.153e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | AGT2; At4g39660; CHLREDRAFT_133057; GSVIVT00019422001; GSVIVT00023979001; LOC_Os03g07570; Os03g0171900; OsI_10205; OsJ_09593; PHYPADRAFT_178763; POPTRDRAFT_1082658; RCOM_0193980; T19P19.50; VITISV_012436; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | alanine-glyoxylate transaminase activity | GO:0008453 | Molecular Function | 0.0 | - |
| Sma3 | transaminase activity | GO:0008483 | Molecular Function | 0.0 | - |
| Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
| Sma3 | photorespiration | GO:0009853 | Biological Process | 0.0 | - |
| Sma3 | arginine catabolic process to glutamate | GO:0019544 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminotransferase class-III | IPR005814 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
| Sma3 | Peptidase S1/S6, chymotrypsin/Hap, active site | IPR018114 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G39660.1 | AGT2 alanine:glyoxylate aminotransferase 2 chr4:18406797-18409262 FORWARD LENGTH=476 | 3.0e-20 | 77% |
| RefSeq | Arabidopsis thaliana | NP_568064.1 | alanine:glyoxylate aminotransferase 2 [Arabidopsis thaliana] | 3.0e-20 | 77% |
| RefSeq | Populus trichocarpa | XP_002310591.1 | predicted protein [Populus trichocarpa] | 2.0e-20 | 79% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW66
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 323 aas, your sequence is shorter than subject: 72 - 482
Fln protein:
S
Protein Length:
73
Fln nts:
C
Fln Alignment:
GG46A6U01DK5J4___LSLMFDENGRRYLDAFAGIVTVSCGHCHPDILEAIRNQNELLQHATTI
A9NW66_______________MQYLFDEDGRRYLDAFAGIVCISCGHCHPEVVDTIVKQTKLLQHTTTI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
