UniGene Name: sp_v3.0_unigene68183
Length: 210 nt
![]() |
---|
>sp_v3.0_unigene68183
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LN01.1|PPR21_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g08070 gb|AAF79838.1|AC026875_18 T6D22.15 [Arabidopsis thaliana] gb|AEE28239.1| pentatricopeptide repea | - | - | 8.0e-17 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
Source | Gene names |
---|---|
Sma3 | At1g08070; At1g20230; At1g68930; At1g71490; At3g14330; At3g61170; At5g09950; At5g16860; At5g39350; F26A9.13; F2K13_10; GSVIVT00000282001; GSVIVT00002558001; GSVIVT00003060001; GSVIVT00003900001; GSVIVT00006516001; GSVIVT00006853001; GSVIVT00006973001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G08070.1 | OTP82 Tetratricopeptide repeat (TPR)-like superfamily protein chr1:2514374-2516599 REVERSE LENGTH=741 | 8.0e-22 | 60% |
RefSeq | Arabidopsis thaliana | NP_172286.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-21 | 60% |
RefSeq | Populus trichocarpa | XP_002302000.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 64% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 130 aas, your sequence is shorter than subject: 69 - 246
Fln protein:
S
Protein Length:
70
Fln nts:
C
Fln Alignment:
GG46A6U01B9RWA___IHGNMELGKSAAESLFELEPENPAIYVLLSNIYAAAGRWDDVAKIRTLMKGRQVKKKPGCSW
D5AAE0_______________MYGNIDLGKHAAECLFQLEPHNAAKYVLLSNIYAAAGRWDDVAKVRKIMKDRGVQKQPGCSW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain