|
||||||
|
UniGene Name: sp_v3.0_unigene68177
Length: 213 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene68177
C |
|
Ace file of the UniGene sp_v3.0_unigene68177
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | copper-transporting ATPase RAN1 [Arabidopsis thaliana] sp|Q9S7J8.1|AHM5_ARATH RecName: Full=Copper-transporting ATPase RAN1; AltName: Full=Protein RESPONSIVE TO ANTAGONIST 1 gb|AAD29109.1|AF082565_1 ATP dependent copper transporter [Arabidopsis thaliana] | - | - | 8.0e-22 | 86% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Sma3 | Heavy metal ATPase | - | - | 9.776e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Copper-exporting ATPase. | EC:3.6.3.4 | - | 5.833e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g44790; GSVIVT00000405001; GSVIVT00021180001; GSVIVT00024633001; GSVIVT00030125001; K23L20.14; OJ1225_F07.30; OJ1524_D08.15; Os02g0172600; Os02g0196600; OsI_06035; OsI_06234; OsJ_05563; OsJ_05752; P0030G02.51; P0473H04.28; PHYPADRAFT_165109; PHYPADRAFT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | copper-exporting ATPase activity | GO:0004008 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | copper ion transport | GO:0006825 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
| Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G44790.1 | RAN1, HMA7 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) chr5:18075846-18079817 REVERSE LENGTH=1001 | 2.0e-27 | 86% |
| RefSeq | Arabidopsis thaliana | NP_199292.1 | copper-transporting ATPase RAN1 [Arabidopsis thaliana] | 2.0e-27 | 86% |
| RefSeq | Populus trichocarpa | XP_002303349.1 | heavy metal ATPase [Populus trichocarpa] | 2.0e-28 | 89% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ20
Fln msg: Distance to subject end: 602 aas, your sequence is shorter than subject: 70 - 998
Fln protein:
V
Protein Length:
71
Fln nts:
C
Fln Alignment:
GG46A6U01DPLWM___DWLKWALVSPVQFIIGKRFYVAAYRALRNGSANMDVLVALGTSAAYFYSVCALIYGAVLHYR
B8LQ20_______________DWLKWALVSPVQFIIGKRFYVAAYRALRNGSANMDVLIALGTSAAYFYSVCALIYGAVFHYR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
