|
||||||
|
UniGene Name: sp_v3.0_unigene68099
Length: 212 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene68099
C |
|
Ace file of the UniGene sp_v3.0_unigene68099
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Isoform 2 of Probable serine/threonine-protein kinase WNK2 n=1 Tax=Oryza sativa Japonica Group RepID=Q65X23-2 | - | - | 2.0e-20 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Sma3 | With no lysine kinase | - | - | 3.78351e-44 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 8.139e-36 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 2.991e-17 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G49160; At1g49160; At1g64630; At3g04910; At3g18750; At3g22420; At3g48260; At3g51630; At5g28080; At5g41990; At5g55560; At5g58350; CHLREDRAFT_162667; CHLREDRAFT_189121; CHLREDRAFT_206084; FLR; GSVIVT00000541001; GSVIVT00000837001; GSVIVT00006916001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | circadian rhythm | GO:0007623 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G55560.1 | Protein kinase superfamily protein chr5:22506477-22507757 REVERSE LENGTH=314 | 9.0e-26 | 69% |
| RefSeq | Arabidopsis thaliana | NP_200367.2 | putative serine/threonine-protein kinase WNK11 [Arabidopsis thaliana] | 1.0e-25 | 69% |
| RefSeq | Populus trichocarpa | XP_002321177.1 | predicted protein [Populus trichocarpa] | 4.0e-27 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRE1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 56 aas, your sequence is shorter than subject: 70 - 289
Fln protein:
S
Protein Length:
71
Fln nts:
C
Fln Alignment:
GG46A6U01BMA4S___NLGLATTLVNDRCAHTVLGTPEFMAPELYEEEYNELVDIYSFGMCLLEMVTLEIPYSECRSVA
B8LRE1_______________DLGLAATLENDHAAHTVIGTPEFMAPELYEEHYNELVDVYSFGMCLLEMVTLEIPYSECRSIA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
