UniGene Name: sp_v3.0_unigene68082
Length: 161 nt
![]() |
---|
>sp_v3.0_unigene68082
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Dof transcription factor n=1 Tax=Pinus pinaster RepID=B0BCH1_PINPS | - | - | 1.0e-18 | 88% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | F-box family protein | - | - | 4.283e-39 | - |
Source | Gene names |
---|---|
Sma3 | 49D11.18; ADOF1; ADOF2; AT4G24060; At1g07640; At1g28310; At1g51700; At1g64620; At2g28810; At2g37590; At2g46590; At3g21270; At3g45610; At3g50410; At3g55370; At4g24060; At4g38000; At5g02460; At5g60200; At5g60850; At5g65590; B1121A12.10; BBF1; BPBF; DAG2; DO |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
Sma3 | photomorphogenesis | GO:0009640 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
Sma3 | cell wall modification | GO:0042545 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | positive regulation of cell cycle | GO:0045787 | Biological Process | 0.0 | - |
Sma3 | GO:0045941 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Thiolase | IPR002155 | - | 0.0 | - |
Sma3 | Hydroxymethylglutaryl-CoA reductase, class I/II | IPR002202 | - | 0.0 | - |
Sma3 | Zinc finger, Dof-type | IPR003851 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - | |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | Tubulin, conserved site | IPR017975 | - | 0.0 | - |
Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G21270.1 | ADOF2, DOF2 DOF zinc finger protein 2 chr3:7474934-7475548 FORWARD LENGTH=204 | 3.0e-21 | 66% |
RefSeq | Arabidopsis thaliana | NP_188764.1 | Dof zinc finger protein DOF3.1 [Arabidopsis thaliana] | 4.0e-21 | 66% |
RefSeq | Populus trichocarpa | XP_002322044.1 | f-box family protein [Populus trichocarpa] | 3.0e-23 | 81% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A878
Fln msg: Distance to subject end: 248 aas, your sequence is shorter than subject: 53 - 348
Fln protein:
V
Protein Length:
54
Fln nts:
C
Fln Alignment:
GG46A6U01CU447___VTQERRSRPHPSQVLKCPRCDSLNTKFCYYNNYNLSQPRHFCKACRRY
D5A878_______________LTGERRARPHPSQVLKCPRCDSLNTKFCYYNNYNLSQPRHFCKACRRY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain