UniGene Name: sp_v3.0_unigene67971
Length: 206 nt
UniGene Fasta |
---|
>sp_v3.0_unigene67971
C |
Ace file of the UniGene sp_v3.0_unigene67971 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA repair protein rad51, putative n=1 Tax=Ricinus communis RepID=B9RR28_RICCO | - | - | 2.0e-18 | 91% |
FL-Next | tr=RAD51-like protein; Pinus sylvestris (Scots pine). | - | - | 0.0 | 100% |
Sma3 | Rad51 DNA recombinase 1 | - | - | 1.208e-08 | - |
Source | Gene names |
---|---|
Sma3 | At5g20850; CHLREDRAFT_190735; CHLREDRAFT_196696; DMC1; GSVIVT00016363001; LOC_Os12g31370; MICPUCDRAFT_58104; MICPUN_112646; OSTLU_33041; Os12g0497300; OsI_12723; OsI_36814; OsI_38408; OsJ_36165; OsRad51A1; OsRad51A2; Ot08g01790; PHATRDRAFT_54533; POPTRDRA |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | damaged DNA binding | GO:0003684 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | DNA-dependent ATPase activity | GO:0008094 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | DNA metabolic process | GO:0006259 | Biological Process | 0.0 | - |
Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
Sma3 | reciprocal meiotic recombination | GO:0007131 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Helix-hairpin-helix motif | IPR000445 | - | 0.0 | - |
Sma3 | IPR001553 | - | 0.0 | - | |
Sma3 | Helix-hairpin-helix DNA-binding motif, class 1 | IPR003583 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Meiotic recombinase Dmc1 | IPR011940 | - | 0.0 | - |
Sma3 | DNA recombination/repair protein Rad51 | IPR011941 | - | 0.0 | - |
Sma3 | DNA recombination and repair protein Rad51, C-terminal | IPR013632 | - | 0.0 | - |
Sma3 | DNA recombination and repair protein, RecA-like | IPR016467 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G20850.1 | ATRAD51, RAD51 RAS associated with diabetes protein 51 chr5:7070758-7072860 REVERSE LENGTH=342 | 1.0e-22 | 87% |
RefSeq | Arabidopsis thaliana | NP_568402.1 | DNA repair protein RAD51-like 1 [Arabidopsis thaliana] | 1.0e-22 | 87% |
RefSeq | Populus trichocarpa | XP_002326313.1 | predicted protein [Populus trichocarpa] | 8.0e-25 | 91% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: G9I492
Fln msg: STOP codon was not found. Distance to subject end: 2 aas, your sequence is shorter than subject: 68 - 323
Fln protein:
R
Protein Length:
69
Fln nts:
C
Fln Alignment:
GG46A6U01D9LUO___DGSAMFAGPQVKPIGGNIIAHASTTRLSLRKGRGEERICKVISS
G9I492_______________DGSAMFAGPQVKPIGGNIIAHASTTRLSLRKGRGEERICKVISS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain