UniGene Name: sp_v3.0_unigene67816
Length: 156 nt
![]() |
---|
>sp_v3.0_unigene67816
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | Isoform 2 of Protein argonaute 1B OS=Oryza sativa subsp. japonica GN=AGO1B | - | - | 0.0 | 77% |
Sma3 | Argonaute family member | - | - | 2.778e-11 | - |
Source | Gene names |
---|---|
Sma3 | AGO1; AGO906; AGO907; AGO911; AGO915; At1g48410; At5g43810; GSVIVT00000886001; GSVIVT00016822001; GSVIVT00020067001; GSVIVT00027767001; MQD19.17; OJ1149_C12.13; OJ1493_H11.13; OSJNBa0005N02.3; OSJNBa0069C14.10-1; Os02g0672200; Os02g0831600; Os04g0566500; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | endoribonuclease activity | GO:0004521 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | siRNA binding | GO:0035197 | Molecular Function | 0.0 | - |
Sma3 | miRNA binding | GO:0035198 | Molecular Function | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | virus induced gene silencing | GO:0009616 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | auxin metabolic process | GO:0009850 | Biological Process | 0.0 | - |
Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
Sma3 | response to far red light | GO:0010218 | Biological Process | 0.0 | - |
Sma3 | RNA interference | GO:0016246 | Biological Process | 0.0 | - |
Sma3 | somatic stem cell maintenance | GO:0035019 | Biological Process | 0.0 | - |
Sma3 | gene silencing by miRNA | GO:0035195 | Biological Process | 0.0 | - |
Sma3 | adventitious root development | GO:0048830 | Biological Process | 0.0 | - |
Sma3 | stem cell development | GO:0048864 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
Sma3 | Stem cell self-renewal protein Piwi | IPR003165 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1785 | IPR014811 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G43810.1 | ZLL, PNH, AGO10 Stabilizer of iron transporter SufD / Polynucleotidyl transferase chr5:17611939-17616562 FORWARD LENGTH=988 | 6.0e-16 | 75% |
RefSeq | Arabidopsis thaliana | NP_001190464.1 | protein PINHEAD [Arabidopsis thaliana] | 7.0e-16 | 75% |
RefSeq | Populus trichocarpa | XP_002318338.1 | argonaute protein group [Populus trichocarpa] | 1.0e-17 | 82% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q7XSA2-2
Fln msg: Distance to subject end: 430 aas, your sequence is shorter than subject: 52 - 1101
Fln protein:
R
Protein Length:
53
Fln nts:
C
Fln Alignment:
GG46A6U01D2RPS___SGREKDCLPQVGQ*EIMMNKKMVNGGTVNSWACVNFSRSVQDSVA
Q7XSA2-2_____________SGREKDVLPRVGQWN-MMNKKMVNGGRVNNWACINFSRNVQDSAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain