UniGene Name: sp_v3.0_unigene67776
Length: 245 nt
![]() |
---|
>sp_v3.0_unigene67776
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ABC transporter G family member 36 n=5 Tax=Brassicaceae RepID=AB36G_ARATH | - | - | 4.0e-11 | 82% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
Sma3 | ATP-binding cassette transporter, putative | - | - | 1.772e-21 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 2.542e-13 | - |
Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 5.247e-10 | - |
Source | Gene names |
---|---|
Sma3 | ABC1; At1g15210; At1g59870; At3g16340; F23H11.19; F9L1.15; GSVIVT00024107001; GSVIVT00032579001; GSVIVT00032583001; GSVIVT00034309001; GSVIVT00034316001; GSVIVT00034319001; GSVIVT00034490001; GSVIVT00034498001; LOC_Os01g52560; LOC_Os06g36090; MYA6.14; Os0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | cadmium ion transmembrane transporter activity | GO:0015086 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus, incompatible interaction | GO:0009817 | Biological Process | 0.0 | - |
Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
Sma3 | negative regulation of defense response | GO:0031348 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Pleiotropic drug resistance protein PDR | IPR005285 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G15210.1 | PDR7, ATPDR7 pleiotropic drug resistance 7 chr1:5231552-5236573 REVERSE LENGTH=1442 | 3.0e-15 | 82% |
RefSeq | Arabidopsis thaliana | NP_172973.1 | ABC transporter G family member 35 [Arabidopsis thaliana] | 4.0e-15 | 82% |
RefSeq | Populus trichocarpa | XP_002298240.1 | ABC transporter family, pleiotropic drug resistance protein [Populus trichocarpa] | 9.0e-14 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NW55
Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 67 aas, your sequence is shorter than subject: 64 - 471
Fln protein:
S
Protein Length:
65
Fln nts:
C
Fln Alignment:
GG46A6U01DIPH1___GMMTVSITSNQQVASIVASAFYCLFNLFSGFFIPKPRIPK
A9NW55_______________GMLTVAISPNAQVAAVISSAFYSIFNLFSGFLITRPQLPR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain