|
||||||
|
UniGene Name: sp_v3.0_unigene67692
Length: 213 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene67692
C |
|
Ace file of the UniGene sp_v3.0_unigene67692
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | sp=Uncharacterized mitochondrial protein AtMg00860; Arabidopsis thaliana (Mouse-ear cress). Mitochondrion. | - | - | 0.0 | 61% |
| Sma3 | Polyprotein | - | - | 4.023e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | H0124B04.16; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g13350; LOC_Os03g26020; LOC_Os10g37610; LOC_Os12g24050; LOC_Os12g24780; MtrDRAFT_AC150244g37v2; OSIGBa0111L12.7; OSIGBa0114M03.4; OSJNBa0026L12.26; OSJNBa0032F06.19; OSJNBa0059D20.8; OSJNBa0060B20.14; O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Intron-encoded nuclease 2 | IPR003611 | - | 0.0 | - |
| Sma3 | Transposase, MuDR, plant | IPR004332 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | FBD | IPR006566 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
| Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | ATMG00860.1 | ORF158 DNA/RNA polymerases superfamily protein chrM:235916-236392 FORWARD LENGTH=158 | 1.0e-14 | 61% |
| RefSeq | Arabidopsis thaliana | NP_085542.1 | hypothetical protein ArthMp075 (mitochondrion) [Arabidopsis thaliana] | 2.0e-14 | 61% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P92523
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 54 aas, your sequence is shorter than subject: 70 - 158
Fln protein:
V
Protein Length:
71
Fln nts:
C
Fln Alignment:
GG46A6U01DIUCR___GMEIPTSIKHLRGFLGLTGYYRKFVKNYARIATPLTTLLKKDAFSWT
P92523_______________GWPEPKNTTELRGFLGLTGYYRRFVKNYGKIVRPLTELLKKNSLKWT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
