UniGene Name: sp_v3.0_unigene67656
Length: 228 nt
![]() |
---|
>sp_v3.0_unigene67656
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=L-ascorbate oxidase; Short=ASO; Short=Ascorbase; Flags: Precursor dbj|BAA07734.1| ascorbate oxidase precursor [Nicotiana tabacum] | - | - | 2.0e-16 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | Putative L-ascorbate oxidase | - | - | 7.31e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | L-ascorbate oxidase. | EC:1.10.3.3 | - | 3.892e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ascorbate and aldarate metabolism | 00053 | 3.892e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 3.892e-08 | % |
Source | Gene names |
---|---|
Sma3 | AAO; AO; AT4g39830; At4g39830; B13-1-1; GSVIVT00011194001; GSVIVT00019442001; GSVIVT00019447001; GSVIVT00019451001; OSJNBa0062E01.2; Os06g0567900; Os09g0365900; OsI_23413; OsI_31082; OsJ_29093; P0441A12.23; P0567G03.40; PHYPADRAFT_142611; POPTRDRAFT_56707 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | L-ascorbate oxidase activity | GO:0008447 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Multicopper oxidase, type 1 | IPR001117 | - | 0.0 | - |
Sma3 | Multicopper oxidase, copper-binding site | IPR002355 | - | 0.0 | - |
Sma3 | Cupredoxin | IPR008972 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 2 | IPR011706 | - | 0.0 | - |
Sma3 | Multicopper oxidase, type 3 | IPR011707 | - | 0.0 | - |
Sma3 | L-ascorbate oxidase, plants | IPR017760 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G21105.1 | Plant L-ascorbate oxidase chr5:7172727-7177409 FORWARD LENGTH=588 | 2.0e-15 | 60% |
RefSeq | Arabidopsis thaliana | NP_680176.5 | L-ascorbate oxidase [Arabidopsis thaliana] | 3.0e-15 | 60% |
RefSeq | Populus trichocarpa | XP_002315068.1 | predicted protein [Populus trichocarpa] | 5.0e-19 | 66% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A889
Fln msg: Overlapping hits, possible frame ERROR between 159 and 150, Unexpected stop codon in the beginning of your sequence, Distance to subject end: 254 aas, your sequence is shorter than subject: 76 - 573
Fln protein:
*
Protein Length:
77
Fln nts:
T
Fln Alignment:
GG46A6U01C2ATS___QGHKMTVVEADGHYVEPVELENLDVYSGETYSVLIKADQDxxxNYWAAVNVRGRKPNTPRGLAILN
D5A889_______________QGHKMTVVEADGHYVEPVEVENLDVYSGESYSVLIRADQDxxxNYWAAVNVRGRKPITPTGLAVLN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain