UniGene Name: sp_v3.0_unigene67612
Length: 234 nt
UniGene Fasta |
---|
>sp_v3.0_unigene67612
C |
Ace file of the UniGene sp_v3.0_unigene67612 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cryptochrome DASH, chloroplastic/mitochondrial n=1 Tax=Solanum lycopersicum RepID=CRYD_SOLLC | - | - | 3.0e-33 | 85% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 38% |
Sma3 | Cryptochrome DASH, chloroplastic/mitochondrial | - | - | 1.826e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Deoxyribodipyrimidine photo-lyase. | EC:4.1.99.3 | - | 2.684e-07 | - |
Source | Gene names |
---|---|
Sma3 | At5g24850; CRY3; CRYD; Cry3; F6A4.60; GSVIVT00032351001; LOC_Os06g45100; OSJNBa0051O02.40; OSJNBb0065C04.7; Os06g0661800; OsI_23997; OsI_24002; OsJ_22248; PHYPADRAFT_200971; POPTRDRAFT_785478; RCOM_0204960; RCOM_0204970; VITISV_014519; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | DNA photolyase activity | GO:0003913 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | photoreceptor activity | GO:0009881 | Molecular Function | 0.0 | - |
Sma3 | FMN binding | GO:0010181 | Molecular Function | 0.0 | - |
Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal | IPR000793 | - | 0.0 | - |
Sma3 | Cryptochrome/DNA photolyase, class 1 | IPR002081 | - | 0.0 | - |
Sma3 | DNA photolyase, FAD-binding/Cryptochrome, C-terminal | IPR005101 | - | 0.0 | - |
Sma3 | DNA photolyase, N-terminal | IPR006050 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
Sma3 | Cryptochrome, DASH | IPR014133 | - | 0.0 | - |
Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
Sma3 | Cryptochrome/DNA photolyase, class 1 conserved site, C-terminal | IPR018394 | - | 0.0 | - |
Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G24850.1 | CRY3 cryptochrome 3 chr5:8535399-8538016 REVERSE LENGTH=526 | 9.99995e-41 | 84% |
RefSeq | Arabidopsis thaliana | NP_568461.2 | cryptochrome DASH [Arabidopsis thaliana] | 2.0e-40 | 84% |
RefSeq | Populus trichocarpa | XP_002330820.1 | predicted protein [Populus trichocarpa] | 1.0e-39 | 82% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPX1
Fln msg: Distance to subject end: 214 aas, your sequence is shorter than subject: 77 - 655
Fln protein:
V
Protein Length:
78
Fln nts:
C
Fln Alignment:
GG46A6U01EQI1T___GAEWFETCLLDYDPCSNYGNWTYGAGVGNDPRE-DRYFSIPKQAQNYDPDGKYVAHWLPDIAKLPRE
B8LPX1_______________GMKYFWDTLLDADLECDALGWQYISGCLPDGREMDRIDNPQFEGYKFDPAGEYVRRWLPELARLPTE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain