SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene67569

Length: 378 nt

UniGene Fasta

>sp_v3.0_unigene67569
CGTCGTGACCTTGGCTGTCACTCAATGTGTGGGCTCAAGGGCATGGAGAAGGGCATCGACGACATCATGGTCGACCTCGCCGCCAAGGACGGGATCGACTGGATCGACTACAAGAAGCAGCTGAAGAAGGCCGAGCAGTGGAACGTCGAAGTCTACTGATCATCATCATCGCCATCATCATCATCGTGCCATTACCATGGAAGGACTTGCATGCATATGCTAATGTTTCTCCCACCTAGTTTTCGTTTTCGCTCCACTTTGGTTGTGCAAAGCTCAAGCTTCGGCCATATATACGCCTTGTATGTAGCGATGAGTGAGTGGCACGGTGAGCATCAAATGAAAAACCATCGTTCGATCAATGTAGATACTGACACACAT

Ace file of the UniGene sp_v3.0_unigene67569

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Ferredoxin-NADP(H) oxidoreductase n=1 Tax=Triticum aestivum RepID=Q8RVZ8_WHEAT	-	-	8.0e-19	100%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	75%
Sma3	Ferredoxin--NADP reductase	-	-	3.66398e-41	-

Source	ECs	Term	Type	e value	Identity
Sma3	Ferredoxin--NADP(+) reductase.	EC:1.18.1.2	-	0.0	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Photosynthesis	00195		0.0	%
Sma3	Metabolic pathways	01100		0.0	%

Source	Gene names
Sma3	AT1G20020; AT5G66190; At1g20020; At5g66190; CT166; FNR; FNRA; GSVIVT00014406001; GSVIVT00036774001; K2A18.27; L-FNRI; L-FNRII; LFNR1; LFNR2; LOC_Os06g01850; OJ1435_F07.32-1; OJ1435_F07.32-2; Os02g0103800; Os06g0107700; OsI_05475; OsI_21320; OsJ_05011; P05

Source	GOs	Term	Type	Identity
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast thylakoid membrane	GO:0009535	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	thylakoid lumen	GO:0031977	Cellular Component	-
Sma3	thylakoid membrane	GO:0042651	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	ferredoxin-NADP+ reductase activity	GO:0004324	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	poly(U) RNA binding	GO:0008266	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	GO:0045156	Molecular Function	-
Sma3	electron transporter, transferring electrons within the noncyclic electron transport pathway of photosynthesis activity	GO:0045157	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	NADP binding	GO:0050661	Molecular Function	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	photosynthesis	GO:0015979	Biological Process	-
Sma3	electron transport chain	GO:0022900	Biological Process	-
Sma3	defense response to bacterium	GO:0042742	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Oxidoreductase FAD/NAD(P)-binding	IPR001433	-	-
Sma3	Flavoprotein pyridine nucleotide cytochrome reductase	IPR001709	-	-
Sma3	Ferredoxin-NADP+ reductase	IPR012146	-	-
Sma3	Ferredoxin Reductase	IPR015701	-	-
Sma3	Ferredoxin reductase-type FAD-binding domain	IPR017927	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G20020.1	ATLFNR2, FNR2 ferredoxin-NADP(+)-oxidoreductase 2 chr1:6942851-6944868 FORWARD LENGTH=369	3.0e-22	93%
RefSeq	Arabidopsis thaliana	NP_001077565.1	ferredoxin--NADP+ reductase [Arabidopsis thaliana]	3.0e-22	93%
RefSeq	Populus trichocarpa	XP_002327750.1	predicted protein [Populus trichocarpa]	5.0e-21	86%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: A9NNX5

Fln msg: your sequence is shorter than subject: 53 - 382

Fln protein: RRDLGCHSMCGLKGMEKGIDDIMVDLAAKDGIDWIDYKKQLKKAEQWNVEVY*

Protein Length: 54

Fln nts: CGTCGTGACCTTGGCTGTCACTCAATGTGTGGGCTCAAGGGCATGGAGAAGGGCATCGACGACATCATGGTCGACCTCGCCGCCAAGGACGGGATCGACTGGATCGACTACAAGAAGCAGCTGAAGAAGGCCGAGCAGTGGAACGTCGAAGTCTACTGA___TCATCATCATCGCCATCATCATCATCGTGCCATTACCATGGAAGGACTTGCATGCATATGCTAATGTTTCTCCCACCTAGTTTTCGTTTTCGCTCCACTTTGGTTGTGCAAAGCTCAAGCTTCGGCCATATATACGCCTTGTATGTAGCGATGAGTGAGTGGCACGGTGAGCATCAAATGAAAAACCATCGTTCGATCAATGTAGATACTGACACACAT

Fln Alignment:

GG46A6U01D7K5B___MCGLKGMEKGIDDIMVDLAAKDGIDWIDYKKQLKKAEQWNVEVY
A9NNX5_______________MCGLKGMEKGIDDIITSLAAEEGIDWNEYKRQMKKSERWNVEVY

SSRs (tot: 2)

Start position	End position	Sequence	Length
159	170	ATC ATC ATC ATC	12
173	185	CAT CAT CAT CAT C	13

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain