UniGene Name: sp_v3.0_unigene67441
Length: 194 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene67441
A |
Ace file of the UniGene sp_v3.0_unigene67441 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | polyprotein [Primula vulgaris] | - | - | 5.0e-12 | 62% |
FL-Next | tr=H0124B04.16 protein; Oryza sativa (Rice). | - | - | 0.0 | 64% |
Source | Gene names |
---|---|
Sma3 | H0124B04.16; LOC_Os03g10000; LOC_Os11g35200; OSJNBa0032F06.19; OSJNBa0054D14.1; OSJNBa0064E16.1; OSJNBb0062H02.17; Os08g0344700; SDM1_42t00005; VITISV_003711; VITISV_018166; VITISV_034528; VITISV_035856; VITISV_039497; VITISV_043911; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Ribosomal protein S15 | IPR000589 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Protein translocase complex, SecE/Sec61-gamma subunit | IPR001901 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
Sma3 | S15/NS1, RNA-binding | IPR009068 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: Q259G0
Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 545 aas, your sequence is shorter than subject: 59 - 1265
Fln protein:
K
Protein Length:
60
Fln nts:
A
Fln Alignment:
GG46A6U01EH5BC___NEIEWAIQELLALGQIRPSTSPFASSVVLVKKKDGTLRMCIDYRALNKKTLKNE
Q259G0_______________NEIEKQVQEMLKKGIIRPSSSPFSSPVLLVKKKDGTWRFCVDYRHLNAITIKNK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain