UniGene Name: sp_v3.0_unigene67374
Length: 237 nt
UniGene Fasta |
---|
>sp_v3.0_unigene67374
C |
Ace file of the UniGene sp_v3.0_unigene67374 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA repair protein radA (radA)-like [Oryza sativa Japonica Group] dbj|BAD45123.1| DNA repair protein radA (radA)-like [Oryza sativa Japonica Group] dbj|BAG91035.1| unnamed protein product [Oryza sativa Japonica Group] | - | - | 1.0e-14 | 62% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
Sma3 | RAD51C protein | - | - | 3.006e-09 | - |
Source | Gene names |
---|---|
Sma3 | At2g45280; F4L23.21; GSVIVT00026402001; MtrDRAFT_AC155883g32v2; Os01g0578000; OsI_02540; OsJ_02328; P0013G02.12-1; P0013G02.12-2; P0022F12.36-1; P0022F12.36-2; POPTRDRAFT_774224; RAD51C; RCOM_1611350; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | DNA-dependent ATPase activity | GO:0008094 | Molecular Function | 0.0 | - |
Sma3 | double-strand break repair via homologous recombination | GO:0000724 | Biological Process | 0.0 | - |
Sma3 | DNA metabolic process | GO:0006259 | Biological Process | 0.0 | - |
Sma3 | reciprocal meiotic recombination | GO:0007131 | Biological Process | 0.0 | - |
Sma3 | male meiosis | GO:0007140 | Biological Process | 0.0 | - |
Sma3 | female meiosis | GO:0007143 | Biological Process | 0.0 | - |
Sma3 | somatic cell DNA recombination | GO:0016444 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR001553 | - | 0.0 | - | |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | DNA recombination and repair protein Rad51, C-terminal | IPR013632 | - | 0.0 | - |
Sma3 | DNA recombination and repair protein, RecA-like | IPR016467 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G45280.2 | RAD51C RAS associated with diabetes protein 51C chr2:18670103-18672041 FORWARD LENGTH=387 | 2.0e-18 | 63% |
RefSeq | Arabidopsis thaliana | NP_566040.1 | DNA repair protein RAD51-like 3 [Arabidopsis thaliana] | 2.0e-18 | 63% |
RefSeq | Populus trichocarpa | XP_002320055.1 | predicted protein [Populus trichocarpa] | 9.0e-18 | 57% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A8N2
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 44 aas, your sequence is shorter than subject: 78 - 346
Fln protein:
S
Protein Length:
79
Fln nts:
C
Fln Alignment:
GG46A6U01AK0JE___IPFHFRQDFEDLALRTRLLGGMAQKLMRLAEKYDTAVVLMNQVTTKMCGGSFQLVPALGNA
D5A8N2_______________VTFHFRQDFEDLALRTRLLGGMSQKLMRLAEEYDTAVVLMNQVTTKFSGGSFQLALALGES
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain