UniGene Name: sp_v3.0_unigene67352
Length: 219 nt
UniGene Fasta |
---|
>sp_v3.0_unigene67352
C |
Ace file of the UniGene sp_v3.0_unigene67352 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Fimbriata-associated protein (Fragment) n=1 Tax=Plantago major RepID=Q1EMN7_PLAMJ | - | - | 3.0e-07 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | Fimbriata-associated protein | - | - | 6.051e-24 | - |
Source | Gene names |
---|---|
Sma3 | ASK1; ASK10; ASK11; ASK12; ASK15; ASK18; ASK2; At1g10230; At1g75950; At3g25650; At4g34210; At4g34470; At5g42190; B1274F11.9; BjSKP1a; BjSKP1c; BjSKP1d; BjSKP1e; BjSKP1f; CHLREDRAFT_128004; F10M10.2; F14N23.11; GSVIVT00014362001; GSVIVT00036126001; GSVIVT0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | spindle | GO:0005819 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | chromosome segregation | GO:0007059 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
Sma3 | negative regulation of DNA recombination | GO:0045910 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SKP1 component | IPR001232 | - | 0.0 | - |
Sma3 | BTB/POZ fold | IPR011333 | - | 0.0 | - |
Sma3 | SKP1 component, dimerisation | IPR016072 | - | 0.0 | - |
Sma3 | SKP1 component, POZ | IPR016073 | - | 0.0 | - |
Sma3 | E3 ubiquitin ligase, SCF complex, Skp subunit | IPR016897 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G42190.1 | ASK2, SKP1B E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein chr5:16854495-16855516 REVERSE LENGTH=171 | 3.0e-11 | 88% |
RefSeq | Arabidopsis thaliana | NP_568603.1 | S-phase kinase-associated protein 1 [Arabidopsis thaliana] | 4.0e-11 | 88% |
RefSeq | Populus trichocarpa | XP_002301954.1 | predicted protein [Populus trichocarpa] | 4.0e-11 | 88% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NX34
Fln msg: Unexpected stop codon in the beginning of your sequence, your sequence is shorter than subject: 49 - 158
Fln protein:
S
Protein Length:
50
Fln nts:
C
Fln Alignment:
GG46A6U01ASDHF___LKGKTPEEIRRTFNLKNDFTPXXXXXXXXXNQWAFE
A9NX34_______________IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
SSRs (tot: 1) |
---|
Start position | End position | Sequence | Length |
---|---|---|---|
105 | 116 | GAG GAG GAG GAG | 12 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain