|
||||||
|
UniGene Name: sp_v3.0_unigene67255
Length: 181 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene67255
C |
|
Ace file of the UniGene sp_v3.0_unigene67255
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin-activating enzyme E1 n=2 Tax=Physcomitrella patens subsp. patens RepID=A9REZ6_PHYPA | - | - | 1.0e-19 | 84% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
| Sma3 | Ubiquitin-activating enzyme E1 | - | - | 7.28675e-44 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g30110; At5g06460; CHLREDRAFT_191903; GSVIVT00001293001; GSVIVT00024047001; LOC_Os03g18380; LOC_Os11g01510; LOC_Os12g01520; MICPUCDRAFT_30909; MICPUN_107000; OSTLU_35452; Os03g0294900; Os07g0692900; Os11g0106400; OsI_27435; OsI_37149; OsI_37167; OsJ_10 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | small protein activating enzyme activity | GO:0008641 | Molecular Function | 0.0 | - |
| Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
| Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
| Sma3 | protein ubiquitination | GO:0016567 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin/SUMO-activating enzyme E1 | IPR000011 | - | 0.0 | - |
| Sma3 | Ubiquitin-activating enzyme repeat | IPR000127 | - | 0.0 | - |
| Sma3 | UBA/THIF-type NAD/FAD binding fold | IPR000594 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Ubiquitin-activating enzyme, E1, active site | IPR018074 | - | 0.0 | - |
| Sma3 | Ubiquitin-activating enzyme, E1 | IPR018075 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G30110.1 | ATUBA1, MOS5, UBA1 ubiquitin-activating enzyme 1 chr2:12852632-12857369 REVERSE LENGTH=1080 | 4.0e-22 | 72% |
| RefSeq | Arabidopsis thaliana | NP_565693.1 | ubiquitin-activating enzyme E1 1 [Arabidopsis thaliana] | 5.0e-22 | 72% |
| RefSeq | Populus trichocarpa | XP_002313233.1 | predicted protein [Populus trichocarpa] | 3.0e-24 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NU65
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 91 aas, your sequence is shorter than subject: 59 - 379
Fln protein:
S
Protein Length:
60
Fln nts:
C
Fln Alignment:
GG46A6U01CU49K___LMCLELYKVILGHRVEKYRNTFANLALPLFSMAEPVPPKITKHLNLSWSIWDR
A9NU65_______________LVCLELYKVILDHKVEKYRNTFANLALPLFSMAEPVPPKIIKHGVLSWSVWDR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
