UniGene Name: sp_v3.0_unigene67235
Length: 247 nt
![]() |
---|
>sp_v3.0_unigene67235
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Elongation factor 2 (Fragment) n=1 Tax=Nicotiana tabacum RepID=Q9FEL2_TOBAC | - | - | 2.0e-35 | 98% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
Sma3 | Elongation factor 2 | - | - | 1.219e-40 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein-synthesizing GTPase. | EC:3.6.5.3 | - | 1.962e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT1G56070; At1g06220; At1g56070; At1g56070/T6H22.13; At1g56075; At5g25230; CHLREDRAFT_24423; CHLREDRAFT_24524; EEF2; EF-2; EF-TU; EF2; EFG2; EFG5; F9P14.8; GSVIVT00005644001; GSVIVT00025739001; H0613H07.5; MICPUCDRAFT_27460; MICPUCDRAFT_47165; MICPUN_1126 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | nuclear speck | GO:0016607 | Cellular Component | 0.0 | - |
Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | regulation of embryo sac egg cell differentiation | GO:0045694 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
Sma3 | Translation elongation factor EFG/EF2, C-terminal | IPR000640 | - | 0.0 | - |
Sma3 | Protein synthesis factor, GTP-binding | IPR000795 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTu/EF1A, domain 2 | IPR004161 | - | 0.0 | - |
Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
Sma3 | Translation elongation factor EFG/EF2, domain IV | IPR005517 | - | 0.0 | - |
Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G56070.1 | LOS1 Ribosomal protein S5/Elongation factor G/III/V family protein chr1:20968245-20971077 REVERSE LENGTH=843 | 1.99965e-42 | 93% |
RefSeq | Arabidopsis thaliana | NP_849818.1 | elongation factor EF-2 [Arabidopsis thaliana] | 3.00018e-42 | 93% |
RefSeq | Populus trichocarpa | XP_002336546.1 | predicted protein [Populus trichocarpa] | 1.4013e-45 | 93% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACX5
Fln msg: Distance to subject end: 72 aas, your sequence is shorter than subject: 82 - 267
Fln protein:
V
Protein Length:
83
Fln nts:
C
Fln Alignment:
GG46A6U01CFFOA___TDAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRPGTPLYNIKA
D5ACX5_______________TDAIHRGGGQIIPTARRVMYASQLTAKPRLLEPVYLVEIQAPENALGGIYGVLNQKRGHVFEEMQRQGTPLYNIKA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain