SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene67147

Length: 300 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene67147
GAAAATGGAATTCATAAGCAATTTATAGCTAGGTACACCCCGTAGCAAAATGGAGTATCTAAAAGTAAGAACAGGACAATCATGGACATGGCCAGGAGTATGTTAAAGGCAAAGCATTTGCCAAATGATTATTGGGCTGAAGTTGTACACTGTGCAGTATACATTTTGAATAGGTGCCCTACAAAAGCAGTGATGATGAGAGTGCCAGAAGAAGCATGGAGTGGGAGAAATCAAGGAGTCACCCACATGAAAGTTTTTGGATGTGTGGCTTATGCATGAGTGACAGCCAAGGTCACGACG

Ace file of the UniGene sp_v3.0_unigene67147 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Copia-type polyprotein, putative n=4 Tax=Arabidopsis thaliana RepID=Q9C739_ARATH	-	-	8.0e-25	59%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	54%
Sma3	Retrotransposon protein, putative, unclassified	-	-	1.396e-08	-

Source	Gene names
Sma3	At2g17490; B1110B01.4; F11I4_21; LOC_Os03g05850; LOC_Os03g26290; LOC_Os03g47410; LOC_Os03g56530; LOC_Os03g61660; LOC_Os10g01750; LOC_Os11g09330; LOC_Os12g05520; LOC_Os12g44200; OSIGBa0134J07.9; OSJNBa0013O08.17; OSJNBa0017O06.12; OSJNBa0053E05.7; OSJNBa00

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	intrinsic to membrane	GO:0031224	Cellular Component	-
Sma3	nucleotide binding	GO:0000166	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	transmembrane signaling receptor activity	GO:0004888	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	tRNA dihydrouridine synthase activity	GO:0017150	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	tRNA processing	GO:0008033	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	innate immune response	GO:0045087	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Toll/interleukin-1 receptor homology (TIR) domain	IPR000157	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	tRNA-dihydrouridine synthase	IPR001269	-	-
Sma3	BRCT domain	IPR001357	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3		IPR010256	-	-
Sma3	Leucine-rich repeat 3	IPR011713	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	ABC-2 type transporter	IPR013525	-	-
Sma3	Aldolase-type TIM barrel	IPR013785	-	-
Sma3	Acyl-CoA N-acyltransferase	IPR016181	-	-
Sma3	tRNA-dihydrouridine synthase, conserved site	IPR018517	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKX7

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 89 aas, your sequence is shorter than subject: 93 - 407

Fln protein: ENGIHKQFIARYTP*QNGVSKSKNRTIMDMARSMLKAKHLPNDYWAEVVHCAVYILNRCPTKAVMMRVPEEAWSGRNQGVTHMKVFGCVAYA*

Protein Length: 94

Fln nts: GAAAATGGAATTCATAAGCAATTTATAGCTAGGTACACCCCGTAGCAAAATGGAGTATCTAAAAGTAAGAACAGGACAATCATGGACATGGCCAGGAGTATGTTAAAGGCAAAGCATTTGCCAAATGATTATTGGGCTGAAGTTGTACACTGTGCAGTATACATTTTGAATAGGTGCCCTACAAAAGCAGTGATGATGAGAGTGCCAGAAGAAGCATGGAGTGGGAGAAATCAAGGAGTCACCCACATGAAAGTTTTTGGATGTGTGGCTTATGCATGAGTGACAGCCAAGGTCACGACG

Fln Alignment:

GG46A6U01AR4WC___NGIHKQFIARYTP*QNGVSKSKNRTIMDMARSMLKAKHLPNDYWAEVVHCAVYILNRCPTKAVMMRVPEEAWSGRNQGVTHMKVFGC
B8LKX7_______________NGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKFWAEAINTATYIVNRTPTIAVKHKTPEEAWSRRKPTVSHFKVFGC

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain