UniGene Name: sp_v3.0_unigene67116
Length: 226 nt
UniGene Fasta |
---|
>sp_v3.0_unigene67116
C |
Ace file of the UniGene sp_v3.0_unigene67116 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Minor allergen Alt a, putative n=4 Tax=fabids RepID=B9T876_RICCO | - | - | 6.0e-22 | 89% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
Sma3 | Minor allergen Alt a, putative | - | - | 5.815e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-hydroxy-1,4-benzoquinone reductase. | EC:1.6.5.7 | - | 3.243e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Chlorocyclohexane and chlorobenzene degradation | 00361 | 3.243e-08 | % | |
Sma3 | Aminobenzoate degradation | 00627 | 3.243e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 3.243e-08 | % |
Source | Gene names |
---|---|
Sma3 | AT4g27270; AT4g36750; At4g27270; At5g54500; At5g58800; B1070A12.15; C7A10.610; CHLREDRAFT_187688; FAP191; GSVIVT00001798001; GSVIVT00005136001; GSVIVT00005137001; GSVIVT00006809001; GSVIVT00008337001; GSVIVT00008488001; GSVIVT00009800001; GSVIVT0002183800 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
Sma3 | NADPH:quinone reductase activity | GO:0003960 | Molecular Function | 0.0 | - |
Sma3 | FMN binding | GO:0010181 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor | GO:0016655 | Molecular Function | 0.0 | - |
Sma3 | 2-hydroxy-1,4-benzoquinone reductase activity | GO:0050625 | Molecular Function | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphotransferase system, HPr serine phosphorylation site | IPR002114 | - | 0.0 | - |
Sma3 | EMSY N-terminal | IPR005491 | - | 0.0 | - |
Sma3 | Flavodoxin/nitric oxide synthase | IPR008254 | - | 0.0 | - |
Sma3 | Flavoprotein WrbA | IPR010089 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G27270.1 | Quinone reductase family protein chr4:13661458-13663243 REVERSE LENGTH=205 | 4.0e-28 | 85% |
RefSeq | Arabidopsis thaliana | NP_194457.2 | Quinone reductase family protein [Arabidopsis thaliana] | 5.0e-28 | 85% |
RefSeq | Populus trichocarpa | XP_002319258.1 | predicted protein [Populus trichocarpa] | 4.0e-29 | 87% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LRI9
Fln msg: your sequence is shorter than subject: 69 - 203
Fln protein:
R
Protein Length:
70
Fln nts:
C
Fln Alignment:
GG46A6U01ELYLH___TFGAGMFEMEQVKGGSPYGSGTFAGDGSRQPSKLELEQAFHQGKYLAGIAKKLKGK
B8LRI9_______________TFGAGMFEMEQVKGGSPYGSGTFAGDGSRQPSKLELEQAFHQGKYLAGIAKKLKGE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain