SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene67038

Length: 203 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene67038
ATTAAGGAATGGAAAATCCCCACATCCATAAAGCATCTACGAGGATTCTCGGGTTGACAGGGTATTATCGCAAGTTTGTTAAGATTTATGGGAGAATAGCAGCACCTCTAACAACATTATTGAAGAAAGATGCATTTTCATGGACTCGAGAAGCAACGAAGGCCTTTGAATATCTTAAATGAGTGACAGCCAAGGTCACGACG

Ace file of the UniGene sp_v3.0_unigene67038 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Unassigned protein	-	-	0.0	-
FL-Next	sp=Uncharacterized mitochondrial protein AtMg00860; Arabidopsis thaliana (Mouse-ear cress). Mitochondrion.	-	-	0.0	63%

Source	Gene names
Sma3	LOC_Os03g05350; LOC_Os03g13350; LOC_Os03g26020; LOC_Os12g24050; OSIGBa0111L12.7; OSIGBa0114M03.4; OSJNBa0067N01.10; OSJNBa0088I22.10; OSJNBb0048D20.16; Os06g0570000; Os09g0135100; VITISV_003711; VITISV_011880; VITISV_013041; VITISV_013478; VITISV_014148;

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	transporter activity	GO:0005215	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	Intron-encoded nuclease 2	IPR003611	-	-
Sma3	Transposase, MuDR, plant	IPR004332	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	General substrate transporter	IPR005828	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Zinc finger, H2C2-type, histone UAS binding	IPR015416	-	-
Sma3	MULE transposase domain	IPR018289	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	ATMG00860.1	ORF158 DNA/RNA polymerases superfamily protein chrM:235916-236392 FORWARD LENGTH=158	6.0e-13	63%
RefSeq	Arabidopsis thaliana	NP_085542.1	hypothetical protein ArthMp075 (mitochondrion) [Arabidopsis thaliana]	8.0e-13	63%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: P92523

Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 37 aas, your sequence is shorter than subject: 60 - 158

Fln protein: *GMENPHIHKASTRILGLTGYYRKFVKIYGRIAAPLTTLLKKDAFSWTREATKAFEYLK*

Protein Length: 61

Fln nts: ATTAAGGAATGGAAAATCCCCACATCCATAAAGCATCTACGAGGATTCTCGGGTTGACAGGGTATTATCGCAAGTTTGTTAAGATTTATGGGAGAATAGCAGCACCTCTAACAACATTATTGAAGAAAGATGCATTTTCATGGACTCGAGAAGCAACGAAGGCCTTTGAATATCTTAAATGAGTGACAGCCAAGGTCACGACG

Fln Alignment:

GG46A6U01ESYCF___LGLTGYYRKFVKIYGRIAAPLTTLLKKDAFSWTREATKAFEYLK
P92523_______________LGLTGYYRRFVKNYGKIVRPLTELLKKNSLKWTEMAALAFKALK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain