|
||||||
|
UniGene Name: sp_v3.0_unigene66920
Length: 234 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene66920
C |
|
Ace file of the UniGene sp_v3.0_unigene66920
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | IPP transferase-like protein [Arabidopsis thaliana] | - | - | 1.0e-15 | 72% |
| FL-Next | Isoform 2 of tRNA dimethylallyltransferase 9 OS=Arabidopsis thaliana GN=IPT9 | - | - | 0.0 | 72% |
| Sma3 | Isopentenyl transferase | - | - | 4.691e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferred entry: 2.5.1.75. | EC:2.5.1.8 | - | 2.456e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g20040; AtIPT9; GSVIVT00023375001; GSVIVT00027788001; IPT; IPT1; MICPUCDRAFT_3167; OSJNBa0069C14.20; Os06g0729800; OsIPT10; OsI_24543; OsJ_22787; PHYPADRAFT_165772; PHYPADRAFT_172286; PHYPADRAFT_231686; PHYPADRAFT_67435; PHYPADRAFT_85626; PHYPADRAFT_95 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | GO:0004811 | Molecular Function | 0.0 | - | |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | tRNA processing | GO:0008033 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | tRNA isopentenyltransferase | IPR002627 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Myb DNA-binding domain, plants | IPR006447 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - | |
| Sma3 | Peptidase M22, glycoprotease, conserved site | IPR017860 | - | 0.0 | - |
| Sma3 | tRNA delta(2)-isopentenylpyrophosphate transferase | IPR018022 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G20040.3 | IPT9 isopentenyltransferase 9 chr5:6767939-6770980 REVERSE LENGTH=469 | 1.0e-20 | 72% |
| RefSeq | Arabidopsis thaliana | NP_568390.2 | tRNA dimethylallyltransferase 9 [Arabidopsis thaliana] | 1.0e-20 | 72% |
| RefSeq | Populus trichocarpa | XP_002300421.1 | tRNA isopentenyltransferase [Populus trichocarpa] | 3.0e-21 | 66% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9C5J6-2
Fln msg: Distance to subject end: 358 aas, your sequence is shorter than subject: 78 - 459
Fln protein:
R
Protein Length:
79
Fln nts:
C
Fln Alignment:
GG46A6U01B75PJ___MSWSSQVKHKKPKVIVISGPTGVGKSRLALQLAKRIGGEIISADSVQVYRGLDVGSAK
Q9C5J6-2_____________LNGNKKKKSEKEKVIVISGPTGAGKSRLAMELAKRLNGEIISADSVQVYKGLDVGSAK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
