UniGene Name: sp_v3.0_unigene66876
Length: 177 nt
UniGene Fasta |
---|
>sp_v3.0_unigene66876
C |
Ace file of the UniGene sp_v3.0_unigene66876 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | subtilisin-like serine protease 2 [Arabidopsis thaliana] emb|CAA17763.1| subtilisin proteinase-like [Arabidopsis thaliana] emb|CAB80215.1| subtilisin proteinase-like [Arabidopsis thaliana] gb|AAL67071.1| putative subtilisin serine protease [Arabidopsis th | - | - | 9.0e-16 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | Subtilisin-like protease | - | - | 8.167e-37 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cucumisin. | EC:3.4.21.25 | - | 1.495e-14 | - |
Source | Gene names |
---|---|
Sma3 | A1751; ARA12; ASP48; AT3G14067; AT4g34980; At2g05920; At3g14067; At3g14240; At4g34980; At5g51750; At5g59810/mmn10_30; At5g67360; GSVIVT00011830001; GSVIVT00011831001; GSVIVT00012462001; GSVIVT00012464001; GSVIVT00012466001; GSVIVT00014936001; GSVIVT000164 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
Sma3 | negative regulation of catalytic activity | GO:0043086 | Biological Process | 0.0 | - |
Sma3 | mucilage metabolic process involved seed coat development | GO:0048359 | Biological Process | 0.0 | - |
Sma3 | mucilage extrusion from seed coat | GO:0080001 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
Sma3 | Pyrophosphate-energised proton pump | IPR004131 | - | 0.0 | - |
Sma3 | Proteinase inhibitor I9 | IPR010259 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Peptidase S8, subtilisin-related | IPR015500 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G34980.1 | SLP2 subtilisin-like serine protease 2 chr4:16656929-16659223 REVERSE LENGTH=764 | 9.0e-21 | 75% |
RefSeq | Arabidopsis thaliana | NP_567972.1 | subtilisin-like serine protease 2 [Arabidopsis thaliana] | 1.0e-20 | 75% |
RefSeq | Populus trichocarpa | XP_002305511.1 | predicted protein [Populus trichocarpa] | 2.0e-20 | 75% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AE86
Fln msg: Distance to subject end: 228 aas, your sequence is shorter than subject: 59 - 394
Fln protein:
R
Protein Length:
60
Fln nts:
C
Fln Alignment:
GG46A6U01BQ8U3___SFSSRGPNIVTTQLLKPDVIAPGVNILAAWTDAVGPTSLPFDSRRTEFNIIS
D5AE86_______________SFSSRGPNPETPEILKPDVIAPGVNILAGWTGAVGPSSLAIDRRRTQFNILS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain