|
||||||
|
UniGene Name: sp_v3.0_unigene66825
Length: 205 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene66825
C |
|
Ace file of the UniGene sp_v3.0_unigene66825
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phosphatidylinositol phoshate kinase n=2 Tax=Physcomitrella patens RepID=B5TVL8_9BRYO | - | - | 5.0e-16 | 79% |
| FL-Next | sp=Phosphatidylinositol 4-phosphate 5-kinase 2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 48% |
| Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, putative | - | - | 2.096e-13 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 1-phosphatidylinositol-4-phosphate 5-kinase. | EC:2.7.1.68 | - | 1.94e-32 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol phosphate metabolism | 00562 | 1.94e-32 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.94e-32 | % | |
| Sma3 | Phosphatidylinositol signaling system | 04070 | 1.94e-32 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g21980; At1g77740; At2g26420; At2g41210; At3g07960; At3g56960; F17A17.30; F24I3.40; F2E2.1; GSVIVT00000653001; GSVIVT00015324001; GSVIVT00030918001; LOC_Os03g24160; LOC_Os03g49800; LOC_Os11g04840; LOC_Os11g04900; LOC_Os12g04700; MtrDRAFT_AC147961g18v2; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | apical plasma membrane | GO:0016324 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic part | GO:0044445 | Cellular Component | 0.0 | - |
| Sma3 | actin monomer binding | GO:0003785 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidylinositol phosphate kinase activity | GO:0016307 | Molecular Function | 0.0 | - |
| Sma3 | 1-phosphatidylinositol-4-phosphate 5-kinase activity | GO:0016308 | Molecular Function | 0.0 | - |
| Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
| Sma3 | endocytosis | GO:0006897 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | establishment of tissue polarity | GO:0007164 | Biological Process | 0.0 | - |
| Sma3 | plant-type cell wall modification | GO:0009827 | Biological Process | 0.0 | - |
| Sma3 | pollen germination | GO:0009846 | Biological Process | 0.0 | - |
| Sma3 | pollen tube growth | GO:0009860 | Biological Process | 0.0 | - |
| Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylinositol metabolic process | GO:0046488 | Biological Process | 0.0 | - |
| Sma3 | root hair cell tip growth | GO:0048768 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, core | IPR002498 | - | 0.0 | - |
| Sma3 | MORN motif | IPR003409 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup | IPR016034 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol-4-phosphate 5-kinase, plant | IPR017163 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G77740.1 | PIP5K2 phosphatidylinositol-4-phosphate 5-kinase 2 chr1:29220632-29223861 FORWARD LENGTH=754 | 5.0e-19 | 76% |
| RefSeq | Arabidopsis thaliana | NP_177897.1 | phosphatidylinositol-4-phosphate 5-kinase 2 [Arabidopsis thaliana] | 7.0e-19 | 76% |
| RefSeq | Populus trichocarpa | XP_002304802.1 | predicted protein [Populus trichocarpa] | 2.0e-18 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q8L796
Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 517 aas, your sequence is shorter than subject: 56 - 754
Fln protein:
S
Protein Length:
57
Fln nts:
C
Fln Alignment:
GG46A6U01CPEG7___RILPDGCGKYLWADGCMYEGEWCKGQNTGKGKVSWPSGATYEGDF
Q8L796_______________RNLQDGRGRYVWMNGNQYTGEWRNGVICGKGVLAWPNGNRYEGQW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
