SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene66774

Length: 303 nt

UniGene Fasta

>sp_v3.0_unigene66774
CGTCGTGACCTTGGCTGTCACTCATTTTGAGCAGGAGAATGATGATCCTATGTCTTTGAAGAAACCACGAGTAGTCTGGTCTGTGGAGCTTCATCAACAATTTGTTAACTCTGTAAATCAGCTTGGAATTGATAAGGCTGTTCCAAAGAGGATACTTGAGATGATGAATGTTCATGGCCTTACAAGGGAGAATGTTGCAAGCCACCTTCAGGTTCTCATTGAGCATTTGGGGATAGTTCTCGGTTGGACCAGCCAACTCTCAACACATATTTGCTGCAGGGTGTTTTTGGGCTATTACCTCTC

Ace file of the UniGene sp_v3.0_unigene66774

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	type-B response regulator [Catharanthus roseus]	-	-	2.0e-21	81%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	73%
Sma3	Type-b response regulator	-	-	2.728e-35	-

Source	Gene names
Sma3	ARP3; ARP4; ARP5; ARR1; ARR10; ARR11; ARR12; ARR14; ARR18; ARR2; AT3G16857; At1g67710; At2g01760; At2g20570; At2g20570/F23N11.11; At2g25180; At2g40970; At3g10760; At3g16857; At4g16110; At4g31920; At5g44190; At5g58080; CHLREDRAFT_111844; CHLREDRAFT_113139;

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	two-component response regulator activity	GO:0000156	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	transcription regulator activity	GO:0030528	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	two-component signal transduction system (phosphorelay)	GO:0000160	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	chloroplast organization	GO:0009658	Biological Process	-
Sma3	cytokinin mediated signaling pathway	GO:0009736	Biological Process	-
Sma3	ethylene mediated signaling pathway	GO:0009873	Biological Process	-
Sma3	negative regulation of flower development	GO:0009910	Biological Process	-
Sma3	regulation of stomatal movement	GO:0010119	Biological Process	-
Sma3	leaf senescence	GO:0010150	Biological Process	-
Sma3	regulation of chlorophyll biosynthetic process	GO:0010380	Biological Process	-
Sma3	regulation of anthocyanin metabolic process	GO:0031537	Biological Process	-
Sma3		GO:0045449	Biological Process	-
Sma3		GO:0045941	Biological Process	-
Sma3	shoot development	GO:0048367	Biological Process	-
Sma3	primary root development	GO:0080022	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	GPCR, rhodopsin-like, 7TM	IPR000276	-	-
Sma3	Signal transduction response regulator, receiver domain	IPR001789	-	-
Sma3	Myb DNA-binding domain, plants	IPR006447	-	-
Sma3		IPR012287	-	-
Sma3		IPR014778	-	-
Sma3	Response regulator, plant B-type	IPR017053	-	-
Sma3	Myb domain, DNA-binding	IPR017930	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G16110.1	ARR2, RR2 response regulator 2 chr4:9112979-9115785 FORWARD LENGTH=664	5.0e-26	83%
RefSeq	Arabidopsis thaliana	NP_193346.4	two-component response regulator ARR2, partial [Arabidopsis thaliana]	7.0e-26	83%
RefSeq	Populus trichocarpa	XP_002311532.1	type-b response regulator, partial [Populus trichocarpa]	7.0e-29	85%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5A9D6

Fln msg: Distance to subject end: 280 aas, your sequence is shorter than subject: 100 - 465

Fln protein: VVTLAVTHFEQENDDPMSLKKPRVVWSVELHQQFVNSVNQLGIDKAVPKRILEMMNVHGLTRENVASHLQVLIEHLGIVLGWTSQLSTHICCRVFLGYYL

Protein Length: 101

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTTTGAGCAGGAGAATGATGATCCTATGTCTTTGAAGAAACCACGAGTAGTCTGGTCTGTGGAGCTTCATCAACAATTTGTTAACTCTGTAAATCAGCTTGGAATTGATAAGGCTGTTCCAAAGAGGATACTTGAGATGATGAATGTTCATGGCCTTACAAGGGAGAATGTTGCAAGCCACCTTCAGGTTCTCATTGAGCATTTGGGGATAGTTCTCGGTTGGACCAGCCAACTCTCAACACATATTTGCTGCAGGGTGTTTTTGGGCTATTACCTCTC

Fln Alignment:

GG46A6U01DKEVN___DDPMSLKKPRVVWSVELHQQFVNSVNQLGIDKAVPKRILEMMNVHGLTRENVASHLQ
D5A9D6_______________DDISSLKRARVHWTVQLHQQFVVAVNQLGIDKAVPKKIVEIMKVQGLSRENVASHLQ

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain