|
||||||
|
UniGene Name: sp_v3.0_unigene66736
Length: 238 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene66736
C |
|
Ace file of the UniGene sp_v3.0_unigene66736
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | S-locus lectin protein kinase family protein n=1 Tax=Glycine max RepID=C6ZRU8_SOYBN | - | - | 8.0e-22 | 70% |
| FL-Next | tr=Somatic embryogenesis receptor-like kinase 1; Pinus massoniana. | - | - | 0.0 | 55% |
| Sma3 | Putative S-receptor kinase | - | - | 5.447e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | 17L07.5; AT4g00340; AT4g32300; A_IG005I10.19; At1g34300; At2g19130; At4g32300; B1099D03.46; B1099D03.51; B1423D04.25; DUPR11.18; F10M6.60; F23M19.5; F5I10.19; F8B4.10; GSVIVT00000338001; GSVIVT00001733001; GSVIVT00001735001; GSVIVT00016916001; GSVIVT00018 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | phospholipase C activity | GO:0004629 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
| Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G19130.1 | S-locus lectin protein kinase family protein chr2:8293789-8296275 FORWARD LENGTH=828 | 2.0e-26 | 68% |
| RefSeq | Arabidopsis thaliana | NP_179503.1 | S-locus lectin protein kinase-like protein [Arabidopsis thaliana] | 3.0e-26 | 68% |
| RefSeq | Populus trichocarpa | XP_002319938.1 | predicted protein [Populus trichocarpa] | 9.0e-27 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5FY57
Fln msg: Distance to subject end: 239 aas, your sequence is shorter than subject: 79 - 626
Fln protein:
R
Protein Length:
80
Fln nts:
C
Fln Alignment:
GG46A6U01C4S0J___GCHSSVYKGTLAGSIPIAVKKL--ERPEGGEKQFRMEVSTIGMIQHINLVRLRGFCSEGDRRLLVYDYMPNGSL
D5FY57_______________GGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
