SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene66676

Length: 402 nt

UniGene Fasta

>sp_v3.0_unigene66676
CGTCGTGACCTTGGCTGTCACTCAAGGCCGATGTCTTTGTGGGAACTGCCTTGGTAGACATGTATGCCAAATCTGGGTGTGTCGAAGATGCACACAAAGTGTTTAACAAAATACCTAGCCGAGATGTGGTTTCATGGAATGCTGTGATTGTAGGATATTCCATGAATGGACGTGCCAAGGAGGCCCTCAAACTCTTTGAACGAATGCAACACTCGGGCACAAACCCAGATAGTGTCACCTTCCTAGGCGTTCTCTCTGCCTGCTGCTATGCGGGCTTTGTGGCTGATGGTTGGAAATACTTTCATTCCATGAGTAGAGATTATAACATAAAACCTGCAATGGAGCACTATTGTTGCATGGTTGACCTTCTTGGCCGAGCTGGGCACTTGAACGAGGCTTCGC

Ace file of the UniGene sp_v3.0_unigene66676

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp\|Q9SIT7.1\|PP151_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g13600 gb\|AAD22682.1\| hypothetical protein [Arabidopsis thaliana] gb\|AEC06244.1\| pentatricopeptide repe	-	-	2.0e-37	57%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	61%
Sma3	Pentatricopeptide repeat-containing protein, putative	-	-	9.43e-23	-

Source	Gene names
Sma3	At1g05750; At1g18485; At1g20230; At1g28690; At1g31430; At1g53600; At2g03880; At2g13600; At2g33680; At2g36730; At3g12770; At3g15930; At3g26782; At3g29230; At3g57430; At4g16470; At4g33170; At4g37380; At4g38010; At4g39530; At5g09950; B1032F05.19; B1045D11.23

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	ubiquitin thiolesterase activity	GO:0004221	Molecular Function	-
Sma3	nuclease activity	GO:0004518	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	ATP-dependent helicase activity	GO:0008026	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	deaminase activity	GO:0019239	Molecular Function	-
Sma3	acireductone synthase activity	GO:0043874	Molecular Function	-
Sma3	metal ion binding	GO:0046872	Molecular Function	-
Sma3	DNA repair	GO:0006281	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	purine ribonucleoside monophosphate biosynthetic process	GO:0009168	Biological Process	-
Sma3	L-methionine salvage from methylthioadenosine	GO:0019509	Biological Process	-
Sma3	methylation	GO:0032259	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Adenosine/AMP deaminase domain	IPR001365	-	-
Sma3	Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1	IPR001578	-	-
Sma3	Helicase, C-terminal	IPR001650	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Argonaute/Dicer protein, PAZ	IPR003100	-	-
Sma3	Putative methylase	IPR004557	-	-
Sma3	Dicer double-stranded RNA-binding fold	IPR005034	-	-
Sma3	Haloacid dehalogenase-like hydrolase	IPR005834	-	-
Sma3	DNA repair protein (XPGC)/yeast Rad	IPR006084	-	-
Sma3	XPG N-terminal	IPR006085	-	-
Sma3	XPG/RAD2 endonuclease	IPR006086	-	-
Sma3	Domain of unknown function DUF659	IPR007021	-	-
Sma3	Methyltransferase small	IPR007848	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Helix-hairpin-helix motif, class 2	IPR008918	-	-
Sma3	2,3-diketo-5-methylthio-1-phosphopentane phosphatase	IPR010041	-	-
Sma3		IPR011523	-	-
Sma3	DNA/RNA helicase, DEAD/DEAH box type, N-terminal	IPR011545	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Methyltransferase type 11	IPR013216	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain	IPR014001	-	-
Sma3		IPR014021	-	-
Sma3		IPR017442	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G13600.1	Pentatricopeptide repeat (PPR) superfamily protein chr2:5671493-5673586 FORWARD LENGTH=697	1.4013e-45	57%
RefSeq	Arabidopsis thaliana	NP_178983.1	pentatricopeptide repeat-containing protein [Arabidopsis thaliana]	2.8026e-45	57%
RefSeq	Populus trichocarpa	XP_002332237.1	predicted protein [Populus trichocarpa]	1.96182e-44	54%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5AB53

Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 45 aas, your sequence is shorter than subject: 133 - 232

Fln protein: S*PWLSLKADVFVGTALVDMYAKSGCVEDAHKVFNKIPSRDVVSWNAVIVGYSMNGRAKEALKLFERMQHSGTNPDSVTFLGVLSACCYAGFVADGWKYFHSMSRDYNIKPAMEHYCCMVDLLGRAGHLNEAS

Protein Length: 134

Fln nts: CGTCGTGACCTTGGCTGTCACTCAAGGCCGATGTCTTTGTGGGAACTGCCTTGGTAGACATGTATGCCAAATCTGGGTGTGTCGAAGATGCACACAAAGTGTTTAACAAAATACCTAGCCGAGATGTGGTTTCATGGAATGCTGTGATTGTAGGATATTCCATGAATGGACGTGCCAAGGAGGCCCTCAAACTCTTTGAACGAATGCAACACTCGGGCACAAACCCAGATAGTGTCACCTTCCTAGGCGTTCTCTCTGCCTGCTGCTATGCGGGCTTTGTGGCTGATGGTTGGAAATACTTTCATTCCATGAGTAGAGATTATAACATAAAACCTGCAATGGAGCACTATTGTTGCATGGTTGACCTTCTTGGCCGAGCTGGGCACTTGAACGAGGCTTCGC

Fln Alignment:

GG46A6U01DUR26___KADVFVGTALVDMYAKSGCVEDAHKVFNKIPSRDVVSWNAVIVGYSMNGRAKEALKLFERMQHSGTNPDSVTFLGVLSACCYAGFVADGWKYFHSMSRDYNIKPAMEHYCCMVDLLGRAGHLNEA
D5AB53_______________ESDVFVGSTLIDMYAKCSSIGDASKVFDGMSTRNVVSWNAMIAAYAIHGCGKQALDLFEQMKHSDTSPNQVTFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGRTGCLDEA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain