|
||||||
|
UniGene Name: sp_v3.0_unigene66647
Length: 240 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene66647
C |
|
Ace file of the UniGene sp_v3.0_unigene66647
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Cycas revoluta RepID=Q56GG4_CYCRE | - | - | 6.0e-18 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 56% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 1.676e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | LOC_Os03g05350; LOC_Os03g06110; LOC_Os03g10000; LOC_Os03g13350; LOC_Os10g13960; LOC_Os10g16880; LOC_Os10g37610; MtrDRAFT_AC150244g37v2; OJ1004_F02.14; OSIGBa0114M03.4; OSJNBa0011L14.8; OSJNBa0014J14.7; OSJNBa0064E16.1; OSJNBa0067N01.10; OSJNBb0018B10.13; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Exostosin-like | IPR004263 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
| Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative Complete
Fln database: coniferopsida.fasta
Fln subject: A9NWN2
Fln msg: atg_distance in limit (1-15): atg_distance = 5, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 48 - 66
Fln protein:
M
Protein Length:
49
Fln nts:
C
Fln Alignment:
GG46A6U01DXGYM___LKDGSWCMCSEYRELNKLTIKYKFLIPVIDELLDELHGAIYFTELD
A9NWN2_______________INDGSYILCNNCRVLNEITIKDKFHISIVDELLDELYGTMYFLELD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
