UniGene Name: sp_v3.0_unigene66424
Length: 163 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene66424
A |
Ace file of the UniGene sp_v3.0_unigene66424
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytosolic aldehyde dehydrogenase RF2D n=3 Tax=Andropogoneae RepID=Q8S529_MAIZE | - | - | 7.0e-16 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
| Sma3 | Aldehyde dehydrogenase, putative | - | - | 1.381e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 3.253e-12 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 3.253e-12 | % | |
| Sma3 | Pentose and glucuronate interconversions | 00040 | 3.253e-12 | % | |
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 3.253e-12 | % | |
| Sma3 | Fatty acid metabolism | 00071 | 3.253e-12 | % | |
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 3.253e-12 | % | |
| Sma3 | Lysine degradation | 00310 | 3.253e-12 | % | |
| Sma3 | Arginine and proline metabolism | 00330 | 3.253e-12 | % | |
| Sma3 | Histidine metabolism | 00340 | 3.253e-12 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 3.253e-12 | % | |
| Sma3 | beta-Alanine metabolism | 00410 | 3.253e-12 | % | |
| Sma3 | Glycerolipid metabolism | 00561 | 3.253e-12 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 3.253e-12 | % | |
| Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 3.253e-12 | % | |
| Sma3 | Propanoate metabolism | 00640 | 3.253e-12 | % | |
| Sma3 | Limonene and pinene degradation | 00903 | 3.253e-12 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.253e-12 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.253e-12 | % | |
| Sma3 | Retinal dehydrogenase. | EC:1.2.1.36 | - | 2.853e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Retinol metabolism | 00830 | 2.853e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.853e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | ALDH1a; ALDH2; ALDH2B4; ALDH2B7; ALDH2a; ALDH2b; ALDH3; Aldh1; At1g23800; At3g48000; F5O8.33; F5O8.35; Os01g0591000; Os01g0591300; Os06g0592400; OsI_02650; OsI_02651; OsI_02656; OsI_23559; OsI_23564; OsJ_02430; OsJ_02431; OsJ_21849; P0502H06.25-1; P0710A0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, C-terminal | IPR016163 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G48000.1 | ALDH2B4, ALDH2, ALDH2A aldehyde dehydrogenase 2B4 chr3:17717082-17719843 REVERSE LENGTH=538 | 2.0e-17 | 61% |
| RefSeq | Arabidopsis thaliana | NP_190383.1 | aldehyde dehydrogenase 2B4 [Arabidopsis thaliana] | 3.0e-17 | 61% |
| RefSeq | Populus trichocarpa | XP_002324977.1 | predicted protein [Populus trichocarpa] | 6.0e-19 | 66% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLF5
Fln msg: Distance to subject end: 24 aas, your sequence is shorter than subject: 54 - 500
Fln protein:
I
Protein Length:
55
Fln nts:
A
Fln Alignment:
GG46A6U01EPA25___IYGLGAGVITKDIDVANRIARSIRAGTVWINCYLAASADSPLGGYKMSGIGREY
B8LLF5_______________IYGLGAGIITKDIDIANRLARSLRVGTVWINCYLVVGADVPLGGYKMSGIGREY

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta