SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene66406

Length: 191 nt

UniGene Fasta

>sp_v3.0_unigene66406
CGTCGTGACCTTGGCTGTCACTCATTTCTTAATAACTTGGAGTGGCATCCAGCAACGGAGAAATTCGTGGCAAGATGGAGTACCTGGCACAAACTGCCCCATACCACCAGGGAAAAACTTTACGTACAAGTTCCAGGTGAAGGACCAAATAGGTAGCTATTTTTACTTTCCATCATTGTATTTCCAGAGAG

Ace file of the UniGene sp_v3.0_unigene66406

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Multicopper oxidase, type 1 [Medicago truncatula]	-	-	5.0e-21	86%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	85%
Sma3	Multicopper oxidase, putative	-	-	1.41699e-40	-

Source	ECs	Term	Type	e value	Identity
Sma3	Oxidoreductases, Acting on diphenols and related substances as donors, With oxygen as acceptor.	EC:1.10.3.-	-	2.307e-07	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Betalain biosynthesis	00965		2.307e-07	%
Sma3	Metabolic pathways	01100		2.307e-07	%
Sma3	Biosynthesis of secondary metabolites	01110		2.307e-07	%
Sma3	L-ascorbate oxidase.	EC:1.10.3.3	-	9.826e-29	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Ascorbate and aldarate metabolism	00053		9.826e-29	%
Sma3	Metabolic pathways	01100		9.826e-29	%

Source	Gene names
Sma3	AT1G76160; AT4g22010; AT4g28090; AT4g37160; AT4g38420; At1g21850; At1g21860; At1g41830; At1g55560; At1g55560/T5A14_2; At1g55570; At1g75790; At1g76160; At2g23630; At3g13390; At3g13400; At4g12420; At4g22010; At4g25240; At4g28090; At4g37160; At4g38420; At5g5

Source	GOs	Term	Type	Identity
Sma3	extracellular region	GO:0005576	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	plant-type cell wall	GO:0009505	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	anchored to plasma membrane	GO:0046658	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	copper ion binding	GO:0005507	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	pectinesterase activity	GO:0030599	Molecular Function	-
Sma3	cell tip growth	GO:0009932	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Multicopper oxidase, type 1	IPR001117	-	-
Sma3	Aminoacyl-tRNA synthetase, class I, conserved site	IPR001412	-	-
Sma3	Lipocalin	IPR002345	-	-
Sma3	Cupredoxin	IPR008972	-	-
Sma3	Multicopper oxidase, type 2	IPR011706	-	-
Sma3	Multicopper oxidase, type 3	IPR011707	-	-
Sma3		IPR013753	-	-
Sma3	Beta tubulin, autoregulation binding site	IPR013838	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G22010.1	sks4 SKU5 similar 4 chr4:11663429-11666463 FORWARD LENGTH=541	2.0e-26	76%
RefSeq	Arabidopsis thaliana	NP_193932.1	protein SKU5 similar 4 [Arabidopsis thaliana]	3.0e-26	76%
RefSeq	Populus trichocarpa	XP_002332613.1	predicted protein [Populus trichocarpa]	3.0e-27	81%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LRP4

Fln msg: Distance to subject end: 408 aas, your sequence is shorter than subject: 63 - 542

Fln protein: VVTLAVTHFLITWSGIQQRRNSWQDGVPGTNCPIPPGKNFTYKFQVKDQIGSYFYFPSLYFQR

Protein Length: 64

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTTCTTAATAACTTGGAGTGGCATCCAGCAACGGAGAAATTCGTGGCAAGATGGAGTACCTGGCACAAACTGCCCCATACCACCAGGGAAAAACTTTACGTACAAGTTCCAGGTGAAGGACCAAATAGGTAGCTATTTTTACTTTCCATCATTGTATTTCCAGAGAG

Fln Alignment:

GG46A6U01E0PKQ___FLITWSGIQQRRNSWQDGVPGTNCPIPPGKNFTYKFQVKDQIGSYFYFPSLYFQR
B8LRP4_______________FLISWSGIQQRRNSWQDGVFGTNCPIPPGQNFTYKFQVKDQIGSYYYFPSMYMHK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain