|
||||||
|
UniGene Name: sp_v3.0_unigene66274
Length: 217 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene66274
T |
|
Ace file of the UniGene sp_v3.0_unigene66274 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | H0515C11.9 protein n=1 Tax=Oryza sativa RepID=Q01MI2_ORYSA | - | - | 3.0e-17 | 70% |
| FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 53% |
| Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g10780; B1160F02.12; B1234D02.1; H0425E08.11; H0515C11.9; H0522A01.6; H0616A11.2; H0820C10.2; LOC_Os03g15450; LOC_Os03g21350; LOC_Os03g23110; LOC_Os03g23200; LOC_Os03g23780; LOC_Os03g26760; LOC_Os03g31930; LOC_Os03g32380; LOC_Os03g34190; LOC_Os03g35430 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | ribonuclease H activity | GO:0004523 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | O-methyltransferase activity | GO:0008171 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: sp_plants
Fln subject: P31843
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 94 aas, your sequence is shorter than subject: 35 - 142
Fln protein:
M
Protein Length:
36
Fln nts:
T
Fln Alignment:
GG46A6U01ESMVP___MCVDFCALNNITVKNC*PLPRIDDLLDQLKDA
P31843_______________MCIDYRALTKVTIKNKYPIPRVDDLFDRLAQA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
