|
||||||
|
UniGene Name: sp_v3.0_unigene66220
Length: 237 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene66220
C |
|
Ace file of the UniGene sp_v3.0_unigene66220
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase n=5 Tax=Malpighiales RepID=PMGI_RICCO | - | - | 7.0e-26 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
| Sma3 | 2,3-bisphosphoglycerate-independent phosphoglycerate mutase | - | - | 8.384e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphoglycerate mutase. | EC:5.4.2.1 | - | 8.647e-29 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 8.647e-29 | % | |
| Sma3 | Methane metabolism | 00680 | 8.647e-29 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 8.647e-29 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 8.647e-29 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 8.647e-29 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 8.647e-29 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 8.647e-29 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 8.647e-29 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 8.647e-29 | % | |
| Sma3 | Metabolic pathways | 01100 | 8.647e-29 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.647e-29 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT3G08590; At1g09780; At3g08590; B1148D12.28; CHLREDRAFT_196305; F17O14.6; F21M12.16; GSVIVT00033622001; LOC_Os03g21260; MICPUCDRAFT_26927; MICPUN_96333; OSJNBa0095J22.15; OSTLU_33106; Os01g0817700; Os03g0330200; Os05g0482700; OsI_04213; OsI_11413; OsI_20 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial envelope | GO:0005740 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | phosphoglycerate mutase activity | GO:0004619 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | glucose catabolic process | GO:0006007 | Biological Process | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent | IPR005995 | - | 0.0 | - |
| Sma3 | Metalloenzyme | IPR006124 | - | 0.0 | - |
| Sma3 | BPG-independent PGAM, N-terminal | IPR011258 | - | 0.0 | - |
| Sma3 | Alkaline phosphatase-like, alpha/beta/alpha | IPR017849 | - | 0.0 | - |
| Sma3 | Beta-ketoacyl synthase, active site | IPR018201 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G08590.1 | Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent chr3:2608683-2611237 REVERSE LENGTH=560 | 4.0e-32 | 74% |
| RefSeq | Arabidopsis thaliana | NP_850542.1 | Phosphoglycerate mutase, 2,3-bisphosphoglycerate-independent [Arabidopsis thaliana] | 5.0e-32 | 74% |
| RefSeq | Populus trichocarpa | XP_002326261.1 | predicted protein [Populus trichocarpa] | 3.0e-31 | 74% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LMV6
Fln msg: Distance to subject end: 288 aas, atg_distance in limit (1-15): atg_distance = 11, W2: There is no M at the beginning, your sequence is shorter than subject: 78 - 377
Fln protein:
V
Protein Length:
79
Fln nts:
C
Fln Alignment:
GG46A6U01DG9QS___VTQGKLVAVVVLDGWGENISDQYNAIHLAKTPTMDFLKKGKPDRWRLIKAHGPAVGLPTEDDMGNSEVGHNAL
B8LMV6_______________IPKGKQLAVIILDGWGEEKPDQYNCIYVAETPTMDSLKKGAPEKWTLIKAHGPAVGLPTEDDMGNSEVGHNAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
