|
||||||
|
UniGene Name: sp_v3.0_unigene66179
Length: 197 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene66179
C |
|
Ace file of the UniGene sp_v3.0_unigene66179
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | S-adenosylmethionine synthase 1 n=24 Tax=Tracheophyta RepID=METK1_VITVI | - | - | 1.0e-18 | 100% |
| FL-Next | sp=S-adenosylmethionine synthase 1; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
| Sma3 | S-adenosylmethionine synthetase | - | - | 1.016e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methionine adenosyltransferase. | EC:2.5.1.6 | - | 1.175e-30 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cysteine and methionine metabolism | 00270 | 1.175e-30 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 1.175e-30 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.175e-30 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.175e-30 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4G01850; AdoMet1; AdoMet3; AdoMet4; AdoMet5; AdoMet6; AdoMet_e2; At2g36880; BYJ90; CC2188; CHLRE_182408; GSVIVT00000624001; GSVIVT00022173001; GSVIVT00022531001; LOC_Os01g18860; METK; METK1; METK2; METK3; METK4; METK5; METM; MSAMS2; MSAMS3; MSAMS4; MSAM |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | methionine adenosyltransferase activity | GO:0004478 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
| Sma3 | cobalt ion binding | GO:0050897 | Molecular Function | 0.0 | - |
| Sma3 | one-carbon metabolic process | GO:0006730 | Biological Process | 0.0 | - |
| Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | S-adenosylmethionine synthetase | IPR002133 | - | 0.0 | - |
| Sma3 | RNA polymerase Rpb7, N-terminal | IPR005576 | - | 0.0 | - |
| Sma3 | RNA polymerase III, subunit Rpc25 | IPR013238 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G17390.1 | MTO3, SAMS3, MAT4 S-adenosylmethionine synthetase family protein chr3:5952484-5953665 REVERSE LENGTH=393 | 6.0e-21 | 100% |
| RefSeq | Arabidopsis thaliana | NP_188365.1 | S-adenosylmethionine synthase 4 [Arabidopsis thaliana] | 8.0e-21 | 100% |
| RefSeq | Populus trichocarpa | XP_002326202.1 | s-adenosylmethionine synthetase 6 [Populus trichocarpa] | 2.0e-20 | 97% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUH8
Fln msg: Separated hits, possible frame ERROR between 140 and 142, Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 259 aas, your sequence is shorter than subject: 65 - 393
Fln protein:
S
Protein Length:
66
Fln nts:
C
Fln Alignment:
GG46A6U01BPTJV___FVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPxEEIGAGDQGHMFGY
A9NUH8_______________FVSADVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPxEEIGAGDQGHMFGY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
