|
||||||
|
UniGene Name: sp_v3.0_unigene65978
Length: 202 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65978
C |
|
Ace file of the UniGene sp_v3.0_unigene65978
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 12-oxophytodienoate reductase 7 n=3 Tax=BEP clade RepID=OPR7_ORYSJ | - | - | 3.0e-12 | 82% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
| Sma3 | 12-oxophytodienoate reductase 3 | - | - | 1.066e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 12-oxophytodienoate reductase. | EC:1.3.1.42 | - | 1.376e-17 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | alpha-Linolenic acid metabolism | 00592 | 1.376e-17 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 1.376e-17 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.376e-17 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT2G06050; At2g06050; DDE1; GSVIVT00002893001; GSVIVT00002894001; GSVIVT00016458001; OPAR; OPR1; OPR3; OPR7; OPR8; Os08g0459600; OsI_22158; OsI_29482; OsJ_27573; P0493A04.35; P0690E03.3; PHYPADRAFT_158472; POPTRDRAFT_672416; POPTRDRAFT_780930; POPTRDRAFT_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | FMN binding | GO:0010181 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | 12-oxophytodienoate reductase activity | GO:0016629 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to fungus | GO:0009620 | Biological Process | 0.0 | - |
| Sma3 | jasmonic acid biosynthetic process | GO:0009695 | Biological Process | 0.0 | - |
| Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
| Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | NADH:flavin oxidoreductase/NADH oxidase, N-terminal | IPR001155 | - | 0.0 | - |
| Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G06050.2 | OPR3 oxophytodienoate-reductase 3 chr2:2359240-2361971 REVERSE LENGTH=391 | 1.0e-16 | 76% |
| RefSeq | Arabidopsis thaliana | NP_001077884.1 | 12-oxophytodienoate reductase 3 [Arabidopsis thaliana] | 1.0e-16 | 76% |
| RefSeq | Populus trichocarpa | XP_002330484.1 | predicted protein [Populus trichocarpa] | 2.0e-15 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NT17
Fln msg: Distance to subject end: 231 aas, your sequence is shorter than subject: 67 - 376
Fln protein:
R
Protein Length:
68
Fln nts:
C
Fln Alignment:
GG46A6U01DGEKK___VVDAVHEKGGIIFCQLWHVGRASHSVYQPDGGAPVSS
A9NT17_______________IVNGVHEKGGVFFCQIWHTGRASHVDYQPNGQAPVSS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
