|
||||||
|
UniGene Name: sp_v3.0_unigene65863
Length: 178 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65863
G |
|
Ace file of the UniGene sp_v3.0_unigene65863
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Hypersensitivity-induced response-like protein n=1 Tax=Cenchrus ciliaris RepID=Q9ATP0_CENCI | - | - | 9.0e-21 | 91% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
| Sma3 | Hypersensitive-induced response protein | - | - | 2.787e-30 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G69840; At1g69840; At3g01290; At5g62740; GSVIVT00000093001; GSVIVT00028994001; GSVIVT00038461001; HIR; HIR1; HIR2; HIR3; LOC_Os10g32700; Lj-HIR1; MQB2.6; MpHIR1; OJ1051_A08.5; OJ1198_B10.17; OSJNBa0071K18.18; Os01g0588400; Os05g0591900; Os06g0136000; O |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
| Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
| Sma3 | 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity | GO:0003871 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | GO:0047210 | Molecular Function | 0.0 | - | |
| Sma3 | methionine biosynthetic process | GO:0009086 | Biological Process | 0.0 | - |
| Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Band 7 protein | IPR001107 | - | 0.0 | - |
| Sma3 | Myosin head, motor domain | IPR001609 | - | 0.0 | - |
| Sma3 | Methionine synthase, vitamin-B12 independent | IPR002629 | - | 0.0 | - |
| Sma3 | Alpha-1,4-glucan-protein synthase, UDP-forming | IPR004901 | - | 0.0 | - |
| Sma3 | Kinetochore protein Ndc80 | IPR005550 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G62740.1 | HIR1, ATHIR1 SPFH/Band 7/PHB domain-containing membrane-associated protein family chr5:25201320-25202535 FORWARD LENGTH=286 | 2.0e-26 | 87% |
| RefSeq | Arabidopsis thaliana | NP_201080.1 | Hypersensitive-induced response protein 1 [Arabidopsis thaliana] | 3.0e-26 | 87% |
| RefSeq | Populus trichocarpa | XP_002323833.1 | predicted protein [Populus trichocarpa] | 4.0e-27 | 89% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LN88
Fln msg: STOP codon was not found. Distance to subject end: 14 aas, your sequence is shorter than subject: 58 - 287
Fln protein:
E
Protein Length:
59
Fln nts:
G
Fln Alignment:
GFXCM5X02GAM1A___ESVLAFSDNVPGTTAKDVILDMVLVTQYFDTMKEIGASSKSSSVFIPHGPGAVRDVAG
B8LN88_______________ESVLAFSDNVPGTTAKDV-MDMVLVTQYFDTMKEIGASSKSSSVFIPHGPGAVRDVAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
