UniGene Name: sp_v3.0_unigene65843
Length: 175 nt
![]() |
---|
>sp_v3.0_unigene65843
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | NADPH-protochlorophyllide oxidoreductase n=2 Tax=Phaseoleae RepID=Q9LKH8_VIGRR | - | - | 8.0e-16 | 100% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
Sma3 | NADPH-protochlorophyllide oxidoreductase | - | - | 2.736e-23 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protochlorophyllide reductase. | EC:1.3.1.33 | - | 4.84849e-43 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Porphyrin and chlorophyll metabolism | 00860 | 4.84849e-43 | % | |
Sma3 | Metabolic pathways | 01100 | 4.84849e-43 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.84849e-43 | % |
Source | Gene names |
---|---|
Sma3 | 3PCR; AT1G03630; AT5G54190; At1g03630; At4g27440; At5g54190; CHLREDRAFT_136589; CipPor; F21B7.24; F21B7.35; F21B7_11; GSVIVT00025838001; GSVIVT00027634001; H0402C08.17; H0801D08.7; K18G13.7; LOC_Os04g58200; LOC_Os10g35370; LPCR-1; NPR; OSJNBa0017E08.8; OS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | plastid outer membrane | GO:0009527 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | NADPH dehydrogenase activity | GO:0003959 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | protochlorophyllide reductase activity | GO:0016630 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | photosynthesis | GO:0015979 | Biological Process | 0.0 | - |
Sma3 | chlorophyll biosynthetic process | GO:0015995 | Biological Process | 0.0 | - |
Sma3 | photosynthesis, dark reaction | GO:0019685 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
Sma3 | Glucose/ribitol dehydrogenase | IPR002347 | - | 0.0 | - |
Sma3 | Light-dependent protochlorophyllide reductase | IPR005979 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G27440.1 | PORB protochlorophyllide oxidoreductase B chr4:13725648-13727107 FORWARD LENGTH=401 | 6.0e-21 | 88% |
RefSeq | Arabidopsis thaliana | NP_001032072.1 | protochlorophyllide reductase A [Arabidopsis thaliana] | 5.0e-21 | 94% |
RefSeq | Populus trichocarpa | XP_002329146.1 | predicted protein [Populus trichocarpa] | 5.0e-21 | 97% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LL45
Fln msg: Distance to subject end: 74 aas, your sequence is shorter than subject: 43 - 118
Fln protein:
M
Protein Length:
44
Fln nts:
G
Fln Alignment:
GFXCM5X02I9XX7___MLTMQEFHRRYHEETGITFASLYPGCIATTGLFREHIP
B8LL45_______________MLTMQEFHRQYHEETGITFASLYPGCIATTGLFREHIP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain