|
||||||
|
UniGene Name: sp_v3.0_unigene65834
Length: 131 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65834
A |
|
Ace file of the UniGene sp_v3.0_unigene65834
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | SCF ubiquitin ligase n=4 Tax=Picea RepID=Q3ZDI8_PICAB | - | - | 2.0e-12 | 88% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Fimbriata-associated protein | - | - | 1.379e-24 | - |
| Source | Gene names |
|---|---|
| Sma3 | ASK1; ASK2; ASK4; At1g20140; At1g75950; At5g42190; B1274F11.9; BjSKP1a; BjSKP1b; BjSKP1c; BjSKP1d; BjSKP1e; BjSKP1f; CHLREDRAFT_128004; GSVIVT00013750001; GSVIVT00014362001; GSVIVT00036126001; GSVIVT00036130001; GSVIVT00036131001; LOC_Os11g26910; MICPUCDR |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | spindle | GO:0005819 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | phragmoplast | GO:0009524 | Cellular Component | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ligase activity | GO:0016874 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | chromosome segregation | GO:0007059 | Biological Process | 0.0 | - |
| Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of DNA recombination | GO:0045910 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SKP1 component | IPR001232 | - | 0.0 | - |
| Sma3 | BTB/POZ fold | IPR011333 | - | 0.0 | - |
| Sma3 | SKP1 component, dimerisation | IPR016072 | - | 0.0 | - |
| Sma3 | SKP1 component, POZ | IPR016073 | - | 0.0 | - |
| Sma3 | E3 ubiquitin ligase, SCF complex, Skp subunit | IPR016897 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G42190.1 | ASK2, SKP1B E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 family protein chr5:16854495-16855516 REVERSE LENGTH=171 | 2.0e-16 | 79% |
| RefSeq | Arabidopsis thaliana | NP_568603.1 | S-phase kinase-associated protein 1 [Arabidopsis thaliana] | 3.0e-16 | 79% |
| RefSeq | Populus trichocarpa | XP_002301954.1 | predicted protein [Populus trichocarpa] | 3.0e-17 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NL63
Fln msg: Distance to subject end: 35 aas, your sequence is shorter than subject: 43 - 158
Fln protein:
K
Protein Length:
44
Fln nts:
A
Fln Alignment:
GFXCM5X02HQSKV___KTWDQEFVKVDQATLFDLILARKFLPFNIKNLLDLTCQTVADM
A9NL63_______________KTWDQEFVKVDQATLFDLILAANYL--NIKNLLDLTCQTVADM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
