UniGene Name: sp_v3.0_unigene65795
Length: 170 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene65795
G |
Ace file of the UniGene sp_v3.0_unigene65795 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peptidyl-prolyl cis-trans isomerase n=4 Tax=Pinaceae RepID=C9EGT5_9CONI | - | - | 4.0e-16 | 97% |
| FL-Next | sp=Peptidyl-prolyl cis-trans isomerase; Pinus halepensis (Aleppo pine). | - | - | 0.0 | 100% |
| Sma3 | Peptidyl-prolyl cis-trans isomerase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidylprolyl isomerase. | EC:5.2.1.8 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 43H1; 46C02.10; At2g16600; At2g21130; At3g55920; At3g56070; At3g62030; At4g34870; At4g38740; At5g13120; B1331F11.9; CHLREDRAFT_185571; CHLREDRAFT_30639; CHLREDRAFT_34270; CYC063; CYN19-3; CYN20-1; CYN20-3; CYP; CYP1; CYP18; CYP18-1; CYP18-2; CYP18-3; CYP1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid lumen | GO:0031977 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | peptide binding | GO:0042277 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to light intensity | GO:0009642 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to mannitol stimulus | GO:0010555 | Biological Process | 0.0 | - |
| Sma3 | cysteine biosynthetic process | GO:0019344 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tetratricopeptide TPR-1 | IPR001440 | - | 0.0 | - |
| Sma3 | Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain | IPR002130 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat-containing domain | IPR013026 | - | 0.0 | - |
| Sma3 | mRNA splicing factor SYF2 | IPR013260 | - | 0.0 | - |
| Sma3 | Tetratricopeptide repeat | IPR019734 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G16600.1 | ROC3 rotamase CYP 3 chr2:7200862-7201383 FORWARD LENGTH=173 | 3.0e-17 | 89% |
| RefSeq | Arabidopsis thaliana | NP_001077901.1 | Peptidyl-prolyl cis-trans isomerase CYP19-1 [Arabidopsis thaliana] | 3.0e-17 | 89% |
| RefSeq | Populus trichocarpa | XP_002313736.1 | predicted protein [Populus trichocarpa] | 5.0e-16 | 81% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: Q5Y2E8
Fln msg: STOP codon was not found. Distance to subject end: 0 aas, your sequence is shorter than subject: 56 - 172
Fln protein:
S
Protein Length:
57
Fln nts:
G
Fln Alignment:
GFXCM5X02H43F9___SQFFICTAQTSWLDGKHVVFGQVVEGLEVVREIEKVG
Q5Y2E8_______________SQFFICTAQTSWLDGKHVVFGQVVEGLEVVREIEKVG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)