UniGene Name: sp_v3.0_unigene65794
Length: 200 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene65794
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | alpha-galactosidase [Arabidopsis thaliana] gb|AAL67017.1| putative alpha-galactosidase [Arabidopsis thaliana] gb|AAM45068.1| putative alpha-galactosidase [Arabidopsis thaliana] gb|AEE79508.1| alpha-galactosidase [Arabidopsis thaliana] | - | - | 2.0e-20 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
Sma3 | Alpha-galactosidase | - | - | 3.968e-33 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alpha-galactosidase. | EC:3.2.1.22 | - | 1.781e-37 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Galactose metabolism | 00052 | 1.781e-37 | % | |
Sma3 | Glycerolipid metabolism | 00561 | 1.781e-37 | % | |
Sma3 | Sphingolipid metabolism | 00600 | 1.781e-37 | % | |
Sma3 | Glycosphingolipid biosynthesis - globo series | 00603 | 1.781e-37 | % |
Source | Gene names |
---|---|
Sma3 | AGA1; At3g56310; At5g08370; At5g08380; CHLREDRAFT_116873; F18O21_270; F8L15_110; GGT-1; GLA; GSVIVT00002617001; GSVIVT00002618001; GSVIVT00011770001; GSVIVT00029420001; LOC_Os10g35070; LOC_Os10g35110; LeaGal; OJ1205_F02.7; OJ1409_C08.26; OSJNBa0041P03; OS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | alpha-galactosidase activity | GO:0004557 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring glycosyl groups | GO:0016757 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, clan GH-D | IPR000111 | - | 0.0 | - |
Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 27 | IPR002241 | - | 0.0 | - |
Sma3 | Glycosyl hydrolase, family 13, all-beta | IPR013780 | - | 0.0 | - |
Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G56310.1 | Melibiase family protein chr3:20882886-20885745 FORWARD LENGTH=437 | 1.0e-24 | 80% |
RefSeq | Arabidopsis thaliana | NP_191190.2 | alpha-galactosidase [Arabidopsis thaliana] | 2.0e-24 | 80% |
RefSeq | Populus trichocarpa | XP_002325481.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-26 | 86% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV07
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 259 aas, your sequence is shorter than subject: 64 - 377
Fln protein:
N
Protein Length:
65
Fln nts:
A
Fln Alignment:
GFXCM5X02GNVUK___NNGVGETPQMGWNSWNFFACAINETVIRETADALISTGLADLGYVYVNIKD
A9NV07_______________NNGVGQTPQMGWNSWNFFACAINETVIRETADALISTGLADLGYVYVNIDD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain