UniGene Name: sp_v3.0_unigene65792
Length: 172 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene65792
G |
Ace file of the UniGene sp_v3.0_unigene65792 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative protein kinase ADK1 [Oryza sativa Japonica Group] | - | - | 4.0e-16 | 89% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
| Sma3 | Putative casein kinase I | - | - | 1.121e-21 | - |
| Source | Gene names |
|---|---|
| Sma3 | ADK1; AT4g14340; AT4g28540; AT4g28860; AT4g28880; At1g03930; At1g04440; At1g72710; At1g72710/F28P22.10; At2g19470; At3g23340; At4g14340; At4g26100; At4g28540; At4g28860; At4g28880; At4g28880/F16A16_10; At5g43320; At5g44100; At5g57015; B1114B07.27-1; B1114 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plasmodesma | GO:0009506 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | auxin metabolic process | GO:0009850 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Alpha-isopropylmalate/homocitrate synthase, conserved site | IPR002034 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF71, ATP-binding domain | IPR002761 | - | 0.0 | - |
| Sma3 | YjgF/Yer057p/UK114 family | IPR006175 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Endoribonuclease L-PSP/chorismate mutase-like | IPR013813 | - | 0.0 | - |
| Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G26100.1 | CK1, CKL1 casein kinase 1 chr4:13227885-13230508 REVERSE LENGTH=450 | 6.0e-18 | 89% |
| RefSeq | Arabidopsis thaliana | NP_194340.1 | casein kinase 1 [Arabidopsis thaliana] | 7.0e-18 | 89% |
| RefSeq | Populus trichocarpa | XP_002306864.1 | predicted protein [Populus trichocarpa] | 1.0e-17 | 89% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUC1
Fln msg: Separated hits, possible frame ERROR between 112 and 127, Distance to subject end: 285 aas, your sequence is shorter than subject: 57 - 481
Fln protein:
A
Protein Length:
58
Fln nts:
G
Fln Alignment:
GFXCM5X02J1132___ANQVYMIDFGLAKKYREPTTHKHIPYRENKNLTGTARxxxxxVNTHLGIEQSRRDD
A9NUC1_______________ANQVYVIDFGLAKKYRDPVSHQHIPYRENKNLTGTARxxxxxMNTHLGIEQSRRDD

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)