UniGene Name: sp_v3.0_unigene65755
Length: 123 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene65755
T |
Ace file of the UniGene sp_v3.0_unigene65755 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP-citrate lyase A-3 [Arabidopsis thaliana] gb|AAC33203.1| Similar to ATP-citrate-lyase [Arabidopsis thaliana] gb|AAM83243.1| At1g09430/F19J9_9 [Arabidopsis thaliana] gb|AAO23582.1| At1g09430/F19J9_9 [Arabidopsis thaliana] gb|AEE28442.1| ATP-citrate lyas | - | - | 2.0e-09 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
Sma3 | ATP-citrate synthase, putative, expressed | - | - | 1.195e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Succinate--CoA ligase (ADP-forming). | EC:6.2.1.5 | - | 8.362e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Citrate cycle (TCA cycle) | 00020 | 8.362e-08 | % | |
Sma3 | Propanoate metabolism | 00640 | 8.362e-08 | % | |
Sma3 | C5-Branched dibasic acid metabolism | 00660 | 8.362e-08 | % | |
Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 8.362e-08 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 8.362e-08 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 8.362e-08 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 8.362e-08 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 8.362e-08 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 8.362e-08 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 8.362e-08 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 8.362e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 8.362e-08 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.362e-08 | % |
Source | Gene names |
---|---|
Sma3 | At1g09430; At1g10670; At1g60810; F19J9.9; F8A5.32; GSVIVT00002749001; GSVIVT00022538001; LOC_Os11g47330; LOC_Os12g37870; Os11g0696200; Os12g0566300; OsI_37024; OsI_38756; OsJ_36536; PHYPADRAFT_174431; PHYPADRAFT_183136; POPTRDRAFT_658317; POPTRDRAFT_82356 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | citrate lyase complex | GO:0009346 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
Sma3 | acetyl-CoA biosynthetic process | GO:0006085 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 10 | IPR001000 | - | 0.0 | - |
Sma3 | ATP-grasp fold, succinyl-CoA synthetase-type | IPR013650 | - | 0.0 | - |
Sma3 | ATP-grasp fold, subdomain 2 | IPR013816 | - | 0.0 | - |
Sma3 | Succinyl-CoA synthetase-like | IPR016102 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G09430.1 | ACLA-3 ATP-citrate lyase A-3 chr1:3042135-3044978 FORWARD LENGTH=424 | 5.0e-14 | 80% |
RefSeq | Arabidopsis thaliana | NP_172414.1 | ATP-citrate lyase A-3 [Arabidopsis thaliana] | 6.0e-14 | 80% |
RefSeq | Populus trichocarpa | XP_002319466.1 | predicted protein [Populus trichocarpa] | 2.0e-14 | 82% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NX46
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 71 aas, your sequence is shorter than subject: 41 - 225
Fln protein:
L
Protein Length:
42
Fln nts:
T
Fln Alignment:
GFXCM5X02J2HB0___LQYARVLIDCATADPDGRKRKKH*VIGGGIANFTDVSATF
A9NX46_______________LQYARVLIDCATANPDGRKRAL--VIGGGIANFTDVSATF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain