UniGene Name: sp_v3.0_unigene65723
Length: 211 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene65723
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phospholipase D n=3 Tax=Oryza sativa RepID=Q69P64_ORYSJ | - | - | 2.0e-15 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
Sma3 | Phospholipase D alpha | - | - | 2.825e-19 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phospholipase D. | EC:3.1.4.4 | - | 4.06e-30 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycerophospholipid metabolism | 00564 | 4.06e-30 | % | |
Sma3 | Ether lipid metabolism | 00565 | 4.06e-30 | % | |
Sma3 | Metabolic pathways | 01100 | 4.06e-30 | % |
Source | Gene names |
---|---|
Sma3 | At1g52570; At3g15730; F6D8.21; GSVIVT00000347001; GSVIVT00016906001; LOC_Os01g07760; LOC_Os03g27370; MSJ11.13; MtrDRAFT_AC149206g21v2; OJ1740_D06.16; OSJNBa0065F09.3; Os01g0172400; Os03g0391400; Os05g0171000; Os09g0421300; OsI_00588; OsI_18631; OsI_31401; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | clathrin-coated vesicle | GO:0030136 | Cellular Component | 0.0 | - |
Sma3 | cytoplasmic vesicle | GO:0031410 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | phospholipase D activity | GO:0004630 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | NAPE-specific phospholipase D activity | GO:0070290 | Molecular Function | 0.0 | - |
Sma3 | fatty acid metabolic process | GO:0006631 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | positive regulation of abscisic acid mediated signaling pathway | GO:0009789 | Biological Process | 0.0 | - |
Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
Sma3 | lipid catabolic process | GO:0016042 | Biological Process | 0.0 | - |
Sma3 | phosphatidylcholine metabolic process | GO:0046470 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Phospholipase D/Transphosphatidylase | IPR001736 | - | 0.0 | - |
Sma3 | Phospholipase D, plant | IPR011402 | - | 0.0 | - |
Sma3 | Phospholipase D | IPR015679 | - | 0.0 | - |
Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G15730.1 | PLDALPHA1, PLD phospholipase D alpha 1 chr3:5330835-5333474 FORWARD LENGTH=810 | 2.0e-14 | 59% |
RefSeq | Arabidopsis thaliana | NP_188194.1 | phospholipase D alpha 1 [Arabidopsis thaliana] | 3.0e-14 | 59% |
RefSeq | Populus trichocarpa | XP_002327429.1 | predicted protein [Populus trichocarpa] | 3.0e-16 | 63% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV59
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 244 aas, your sequence is shorter than subject: 42 - 482
Fln protein:
K
Protein Length:
43
Fln nts:
A
Fln Alignment:
GFXCM5X02HIAS9___KDQVIDKSIQCAYIEAIRRARDFIYIQNQYFFGSCASWDRD----*DCGCLHLIPIE
A9NV59_______________KDNIIDRSIQDAYINAIRRAKDFIYIENQYFLGSSYGWKPDDIKGQDIGALHLIPKE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain