UniGene Name: sp_v3.0_unigene65707
Length: 230 nt
![]() |
---|
>sp_v3.0_unigene65707
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Mitogen activated protein kinase 1 n=2 Tax=Selaginella moellendorffii RepID=D8QQG3_SELML | - | - | 7.0e-24 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | MAP kinase | - | - | 1.75899e-40 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Transferring phosphorous-containing groups, Phosphotransferases with an alcohol group as acceptor. | EC:2.7.1.- | - | 9.349e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pentose phosphate pathway | 00030 | 9.349e-06 | % | |
Sma3 | Lipopolysaccharide biosynthesis | 00540 | 9.349e-06 | % | |
Sma3 | Nicotinate and nicotinamide metabolism | 00760 | 9.349e-06 | % | |
Sma3 | Metabolic pathways | 01100 | 9.349e-06 | % | |
Sma3 | Mitogen-activated protein kinase. | EC:2.7.11.24 | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | AP22.98; AT1G10210; Asmap1; At1g01560; At1g07880; At1g10210; At1g59580; At2g18170; At2g43790; At2g46070; At3g45640; At3g59790; At4g11330; At4g36450; BIMK1; C7A10.910; CHLREDRAFT_183031; CHLREDRAFT_193901; CHLREDRAFT_78072; CrMPK1; CrMPK2; ERK1; F14N23.9; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | MAP kinase activity | GO:0004707 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | activation of MAPK activity involved in osmosensory signaling pathway | GO:0000169 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | intracellular protein kinase cascade | GO:0007243 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | camalexin biosynthetic process | GO:0010120 | Biological Process | 0.0 | - |
Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
Sma3 | ovule development | GO:0048481 | Biological Process | 0.0 | - |
Sma3 | response to indolebutyric acid stimulus | GO:0080026 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
Sma3 | Gonadotropin-releasing hormone | IPR002012 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
Sma3 | Dihydroneopterin aldolase/epimerase domain | IPR006157 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | JNK MAP kinase | IPR008351 | - | 0.0 | - |
Sma3 | MAP kinase, p38 | IPR008352 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Pleckstrin homology-like domain | IPR011993 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G36450.1 | ATMPK14, MPK14 mitogen-activated protein kinase 14 chr4:17210245-17211413 REVERSE LENGTH=361 | 1.0e-28 | 77% |
RefSeq | Arabidopsis thaliana | NP_195363.1 | mitogen-activated protein kinase 14 [Arabidopsis thaliana] | 1.0e-28 | 77% |
RefSeq | Populus trichocarpa | XP_002334994.1 | predicted protein [Populus trichocarpa] | 3.0e-29 | 77% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P1S7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 114 aas, your sequence is shorter than subject: 76 - 368
Fln protein:
S
Protein Length:
77
Fln nts:
A
Fln Alignment:
GFXCM5X02JASYO___TMFVSTRWYRAPELLLSCDEYGPSIDVWSVGCILAELLGRQPIFPGKDYINQLKLIINVIGSP
A9P1S7_______________TEYVVTRWYRAPELLLSCEEYGTSIDIWSVGCIFAELLGRKPIFPGKDYINQLKLIVNVLGSP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain