UniGene Name: sp_v3.0_unigene65689
Length: 200 nt
![]() |
---|
>sp_v3.0_unigene65689
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 3-ketoacyl-CoA thiolase B, putative n=1 Tax=Ricinus communis RepID=B9S554_RICCO | - | - | 1.0e-17 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | 3-ketoacyl-CoA thiolase B, putative | - | - | 1.023e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Acetyl-CoA C-acyltransferase. | EC:2.3.1.16 | - | 1.251e-28 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid elongation in mitochondria | 00062 | 1.251e-28 | % | |
Sma3 | Fatty acid metabolism | 00071 | 1.251e-28 | % | |
Sma3 | Valine, leucine and isoleucine degradation | 00280 | 1.251e-28 | % | |
Sma3 | Geraniol degradation | 00281 | 1.251e-28 | % | |
Sma3 | Benzoate degradation | 00362 | 1.251e-28 | % | |
Sma3 | alpha-Linolenic acid metabolism | 00592 | 1.251e-28 | % | |
Sma3 | Ethylbenzene degradation | 00642 | 1.251e-28 | % | |
Sma3 | Biosynthesis of unsaturated fatty acids | 01040 | 1.251e-28 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 1.251e-28 | % | |
Sma3 | Metabolic pathways | 01100 | 1.251e-28 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.251e-28 | % |
Source | Gene names |
---|---|
Sma3 | ATO1; At1g04710; At2g33150; At5g48880; CHLREDRAFT_138637; F25I18.11; GSVIVT00020472001; K24G6.22; KAT1; KAT2; KAT5; LOC_Os10g31950; OJ1136_C12.17; OSJNBb0011A08.2; Os02g0817700; Os10g0457600; OsI_09452; OsI_33888; OsJ_31778; PED1; PHYPADRAFT_125611; POPTR |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | glyoxysome | GO:0009514 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | acetyl-CoA C-acyltransferase activity | GO:0003988 | Molecular Function | 0.0 | - |
Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Thiolase | IPR002155 | - | 0.0 | - |
Sma3 | Thiolase-like, subgroup | IPR016038 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G33150.1 | PKT3, PED1, KAT2 peroxisomal 3-ketoacyl-CoA thiolase 3 chr2:14047814-14050983 REVERSE LENGTH=462 | 1.0e-18 | 71% |
RefSeq | Arabidopsis thaliana | NP_180873.1 | 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana] | 2.0e-18 | 71% |
RefSeq | Populus trichocarpa | XP_002299284.1 | predicted protein [Populus trichocarpa] | 4.0e-19 | 68% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LMA1
Fln msg: Overlapping hits, possible frame ERROR between 86 and 65, STOP codon was not found. Distance to subject end: 0 aas, your sequence is shorter than subject: 66 - 462
Fln protein:
G
Protein Length:
67
Fln nts:
C
Fln Alignment:
GFXCM5X02F5312___GARCVATLLHEMKRRGKDLLxxxxxxxxIGTGMGAAAVFERSGAVDQLCNARPIKDHTSLSKDAQ
B8LMA1_______________GARCVATLLHEMKRRGKDCRxxxxxxxxIGTGMGAAAVFERSGAVDQLCNARPIKDHTSLSRDAQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain